Aviva Systems Biology PDE6D Antibody - N-terminal region (ARP73034_P050) Product Number ARP73034_P050 Product Page http://www.avivasysbio.com/pde6d-antibody-n-terminal-region-arp73034-p050.html Product Name PDE6D Antibody - N-terminal region (ARP73034_P050) Size 100 ul Gene Symbol PDE6D Alias Symbols PDE6D, PDED, Protein Size (# AA) 150 amino acids Molecular Weight 16kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 5147 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Description This is a rabbit polyclonal antibody against PDE6D. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: NLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQ Description of PDE6D acts as a GTP specific dissociation inhibitor (GDI). It increases the affinity of Target ARL3 for GTP by several orders of magnitude and does so by decreasing the nucleotide dissociation rate. It stabilizes ARL3-GTP by decreasing the nucleotide dissociation. Protein Interactions ARL16; ARL2; UBC; PTGIR; COPS5; CUL1; FAM219A; ARL15; RND1; GRK7; RAD23A; ARL3; CETN3; RAB13; RAB18; RHEB; RPGR; HRAS; GRK1; RAP2B; RAP1A; RHOA; RHOB; RAB8A; GNAI1; RASA1; CDC42; Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 6-8 weeks delivery International: 6-8 weeks *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges Blocking Peptide For anti-PDE6D (ARP73034_P050) antibody is Catalog # AAP73034 Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human PDE6D Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PDE6D. Swissprot Id O43924 Protein Accession NP_002592 # 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PDE6D. Replacement Item This antibody may replace item sc-166836 from Santa Cruz Biotechnology. Conjugation ARP73034_P050-FITC Conjugated Options ARP73034_P050-HRP Conjugated ARP73034_P050-Biotin Conjugated CB Replacement sc-166836; sc-166854; sc-166855; sc-376724; sc-50260; sc-50262 Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish Application WB Predicted Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Homology Based Rabbit: 100%; Rat: 100%; Zebrafish: 93% on Immunogen Sequence Image 1: Human 293T Host: Rabbit Target Name: PDE6D Sample Type: 293T Whole Cell lysates Antibody Dilution: 1.0ug/ml AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users. 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2.
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-