Alg14 (NM 024178) Mouse Tagged ORF Clone Product Data

Alg14 (NM 024178) Mouse Tagged ORF Clone Product Data

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MR202409 Alg14 (NM_024178) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Alg14 (NM_024178) Mouse Tagged ORF Clone Tag: Myc-DDK Symbol: Alg14 Synonyms: 5430428G01Rik; AI854024 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MR202409 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCTGAGCATTCTGATTCTAGCTGCTACAGCCGCAGGGCTAGTGATCTTGCTATTCCAGCGACTATGGA CCGTGCTTGGGCCCCATCACGTCACTCCCCGAGAGTCTCTCAGACTCTTGATCGTGGCTGGATCCGGTGG ACACACCACTGAGATCTTGAGGCTGGTTGGAAGCTTGTCCAATGCCTATTCACCAAGGCATTATGTCATT GCTGAGTCTGATGAAATGAGTGCCAAGAAAATCCATTCTCTTGAAGAACTCTCTCGAGCCCAGAATGACT CTACTACTGAATACCCCAAGTACCACCTTCACCGAATTCCGAGAAGCCGGGAGGTTCGGCAGTCCTGGCT CTCCTCTGTGTTCACTACCTTCTACTCCATGTGGTTCTCCTTCCCACTGGTTCTCCGAATAAAGCCAGAT TTGGTGCTGTGTAATGGACCAGGAACATGCGTCCCTATCTGTGTGTCCGCCCTGCTTCTTGGGATACTTG GAGTGAAGAAAGTGATCATCGTCTATGTCGAGAGCATCTGCCGAGTGGAGACGCTATCCCTGTCAGGGAA GATCCTGAGGCACCTCTCCGACTACTTCATTGTTCAGTGGCCCACTCTCAAGGAGAAGTACCCCAAGTCT GTGTACCTGGGGCGAATTGTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Alg14 (NM_024178) Mouse Tagged ORF Clone – MR202409 Protein Sequence: >MR202409 protein sequence Red=Cloning site Green=Tags(s) MLSILILAATAAGLVILLFQRLWTVLGPHHVTPRESLRLLIVAGSGGHTTEILRLVGSLSNAYSPRHYVI AESDEMSAKKIHSLEELSRAQNDSTTEYPKYHLHRIPRSREVRQSWLSSVFTTFYSMWFSFPLVLRIKPD LVLCNGPGTCVPICVSALLLGILGVKKVIIVYVESICRVETLSLSGKILRHLSDYFIVQWPTLKEKYPKS VYLGRIV myc-FLAG tag Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_024178 ORF Size: 654 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Alg14 (NM_024178) Mouse Tagged ORF Clone – MR202409 OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_024178.1 RefSeq Size: 910 bp RefSeq ORF: 654 bp Locus ID: 66789 UniProt ID: Q9D081 MW: 24.4 kDa Gene Summary: Involved in protein N-glycosylation. Essential for the second step of the dolichol-linked oligosaccharide pathway. Anchors the catalytic subunit ALG13 to the ER (By similarity). [UniProtKB/Swiss-Prot Function] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us