
VIM antibody - N-terminal region (ARP48225_P050) Data Sheet Product Number ARP48225_P050 Product Name VIM antibody - N-terminal region (ARP48225_P050) Size 50ug Gene Symbol VIM Alias Symbols FLJ36605 Nucleotide Accession# NM_003380 Protein Size (# AA) 466 amino acids Molecular Weight 54kDa Product Format Lyophilized powder NCBI Gene Id 7431 Host Rabbit Clonality Polyclonal Official Gene Full Name Vimentin Gene Family IFF3 This is a rabbit polyclonal antibody against VIM. It was validated on Western Blot using a cell lysate as a positive Description control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR Target Reference Dawson,S.J. (2008) Biochemistry 47 (18), 5127-5138 Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.Along with Description of Target the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well- characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin (MIM 125660) is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. CAPN1, MEN1, ABLIM1, ALS2CR11, APIP, ARMCX2, ATN1, BFSP1, BHLHE40, BRD1, C1orf103, C7orf36, Partner Proteins C7orf64, CAMK2D, CAPN1, CASP3, CASP6, CASP7, CASP8, CASP9, CDH5, CDK1, CHD3, COPS6, CRCT1, CREB1, CRMP1, DCTN1, DEFB1, DIS3L2, DNM1L, DPPA4, DSP, DYNLL1, FABP4, FAM107A, FUBP1, GFAP, GOPC, HABP4, HAP1, HM Reconstitution and Add 50 ul of distilled water. Final anti-VIM antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For Storage longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-VIM antibody is Catalog # AAP48225 (Previous Catalog # AAPS22911) Immunogen The immunogen for anti-VIM antibody: synthetic peptide directed towards the N terminal of human VIM Swissprot Id P08670 Protein Name Vimentin Protein Accession # NP_003371 Purification Affinity Purified Species Reactivity Mouse, Sheep, Human, Guinea pig, Dog, Horse, Rabbit, Rat, Bovine Application IHC, WB Predicted Homology Based on Immunogen Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% Sequence Human brain WB Suggested Anti-VIM Antibody Titration: 0.2-1 ug/ml Positive Control: Human brain Image 1 Sample Type : Human brain stem Human brain stem cells Primary Antibody Dilution : 1:500 Secondary Antibody : Goat anti-rabbit Alexa-Fluor 594 Secondary Antibody Dilution : Image 2 1:1000 Color/Signal Descriptions : VIM: Red DAPI:Blue Gene Name : VIM Submitted by : Dr. Yuzhi Chen, University of Arkansas for Medical Science Human COS7 submitted by:Carl LundinStanford UniversityThe Vimentin Image 3 antibody ARP48225_P050 works well for visualization of the vimentin cytoskeleton (see attached images). We used PFA- fixed COS-7 cells and an antibody dilution of 1:400. __________________________________________________________________________________________________________________________________________________________________ This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users..
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-