KCNN2 antibody - middle region (ARP35439_P050) Data Sheet Product Number ARP35439_P050 Product Name KCNN2 antibody - middle region (ARP35439_P050) Size 50ug Gene Symbol KCNN2 Alias Symbols KCa2.2; SK2; SKCA2; hSK2 Nucleotide Accession# NM_170775 Protein Size (# AA) 231 amino acids Molecular Weight 26kDa Product Format Lyophilized powder NCBI Gene Id 3781 Host Rabbit Clonality Polyclonal Official Gene Full Name Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 Gene Family KCN This is a rabbit polyclonal antibody against KCNN2. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ Target Reference Morimoto,T., (2007) J. Pharmacol. Sci. 104 (1), 94-98 KCNN2 is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This protein is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for KCNN2.Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of Description of Target synaptic AHP.Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by this gene is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin- binding subunits. This gene is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for this gene. Reconstitution and Add 50 ul of distilled water. Final anti-KCNN2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-KCNN2 antibody is Catalog # AAP35439 (Previous Catalog # AAPP06677) Immunogen The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the middle region of human KCNN2 Swissprot Id Q6PJI0 Protein Name Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 EMBL AAH15371.1 Anti-KCNN2 ARP35439_P050 has recently been referenced in the following publications: Publications Chakroborty, S. et al. Early presynaptic and postsynaptic calcium signaling abnormalities mask underlying synaptic depression in presymptomatic Alzheimers disease mice. J. Neurosci. 32, 834153 (2012). WB, IHC, Mouse 22699914 Protein Accession # NP_740721 Purification Affinity Purified Species Reactivity Mouse, Rat, Bovine, Dog, Pig, Horse, Rabbit, Guinea pig, Human, Zebrafish Application IHC, WB Predicted Homology Predicted Homology Based on Immunogen Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93% Sequence Human Muscle WB Suggested Anti-KCNN2 Antibody Titration: 0.2-1 ug/ml Image 1 ELISA Titer: 1:62500 Positive Control: Human Muscle Sample Type : Rhesus macaque spinal cord Rhesus macaque spinal cord Primary Antibody Dilution : 1:300 Secondary Antibody : Donkey anti Rabbit 488 Secondary Antibody Dilution : Image 2 1:500 Color/Signal Descriptions : Green: KCNN2 Gene Name : KCNN2 Submitted by : Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706 Hum. Fetal Muscle Host: Rabbit Target Name: KCNN2 Image 3 Sample Tissue: Human Fetal Muscle Antibody Dilution: 1.0ug/ml Hum. Fetal Lung Host: Rabbit Target Name: KCNN2 Image 4 Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0ug/ml Hum. Fetal Heart Host: Rabbit Target Name: KCNN2 Sample Tissue: Human Fetal Heart Image 5 Antibody Dilution: 1.0ug/ml __________________________________________________________________________________________________________________________________________________________________ This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users..
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages3 Page
-
File Size-