Rit2 (NM 009065) Mouse Tagged ORF Clone – MG202437 | Origene

Rit2 (NM 009065) Mouse Tagged ORF Clone – MG202437 | Origene

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MG202437 Rit2 (NM_009065) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Rit2 (NM_009065) Mouse Tagged ORF Clone Tag: TurboGFP Symbol: Rit2 Synonyms: RIBA; Rin; Roc2 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MG202437 representing NM_009065 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAAGTAGAAAACGAAGCCCACTGCTGCCCTGGCAGCTCATCAGGCGGGTCCAGAGAGTACAAGGTGG TAATGCTGGGCGCAGGGGGCGTTGGTAAAAGCGCAGTCACAATGCAGTTTATAAGCCACCAGTTCCCGGA CTATCACGACCCCACAATCGAAGATGCTTATAAAACCCAGGTGAGGATTGATAATGAGCCTGCTTACTTA GACATCTTGGACACTGCTGGTCAGGCAGAGTTCACGGCCATGCGGGAGCAGTACATGCGTGGGGGAGAGG GCTTCATCATCTGCTATTCTGTCACTGACCGCCAGTCATTCCAGGAGGCTGCCAAGTTCAAGGAGCTTAT TTTCCAGGTCCGTCACACCTATGAAATTCCCCTTGTGCTAGTGGGTAACAAAATTGACTTGGAGCAGTTC CGTCAGGTATCTACAGAAGAAGGCATGAATCTTGCTCGAGACTACAACTGTGCCTTCTTTGAGACATCTG CAGCCCTGCGATTCGGTATCGATGATGCTTTTCAAGGCTTAGTGAGAGAAATTCGCAGGAAGGAATCCAT GCTGTCCTTGGTGGAAAGGAAATTGAAGAGGAAGGACAGCCTGTGGAAGAAGATAAAAGCCTCCCTGAAG AAGAAGAGAGAAAACATGTTG ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >MG202437 representing NM_009065 Red=Cloning site Green=Tags(s) MEVENEAHCCPGSSSGGSREYKVVMLGAGGVGKSAVTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYL DILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQF RQVSTEEGMNLARDYNCAFFETSAALRFGIDDAFQGLVREIRRKESMLSLVERKLKRKDSLWKKIKASLK KKRENML TRTRPLE - GFP Tag - V This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Rit2 (NM_009065) Mouse Tagged ORF Clone – MG202437 Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_009065 ORF Size: 651 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Rit2 (NM_009065) Mouse Tagged ORF Clone – MG202437 RefSeq: NM_009065.2, NP_033091.1 RefSeq Size: 1851 bp RefSeq ORF: 654 bp Locus ID: 19762 UniProt ID: P70425 Gene Summary: Binds and exchanges GTP and GDP. Binds and modulates the activation of POU4F1 as gene expression regulator.[UniProtKB/Swiss-Prot Function] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us