Coatopathies: Genetic Disorders of Protein Coats

Coatopathies: Genetic Disorders of Protein Coats

Coatopathies: Genetic Disorders of Protein Coats Juan S. Bonifacino, PhD Section on Intracellular Protein Trafficking Cell Biology and Neurobiology Branch Section on Intracellular Protein Trafficking Section on Intracellular Protein Trafficking • Molecular mechanisms of protein and organelle distribution within the cell Section on Intracellular Protein Trafficking • Molecular mechanisms of protein and organelle distribution within the cell • Dysfunction in human disease Hermansky-Pudlak syndrome (HPS) MEDNIK syndrome Hereditary spastic paraplegias (HSP) Progressive cerebral cerebellar atrophy (PCCA) Electron Microscopy of a Pituitary Cell Lydia Yuan Sorting Signals Cargo Protein Lumen Cytosol Sorting Signals Adaptors Cargo Protein Adaptor Lumen Cytosol Adaptors Protein Coats Cargo Protein Adaptor Protein Coat Lumen Cytosol Protein Coats Cargo Protein Adaptor Protein Coat Lumen Cytosol Clathrin-coated Vesicles Perry & Gilbert Clathrin-coated Vesicles Perry & Gilbert The Endomembrane System Cytosol Plasma Endocytic membrane recycling Lysosome- domain 1 compartment related (ERC) organelle (LRO) Tubular endosomal network Sorting ER-Golgi (TEN) endosome intermediate compartment (ERGIC) Trans-Golgi Golgi network Endoplasmic complex (TGN) reticulum Late (ER) Plasma endosome/ membrane Lysosome multivesicular domain 2 body Protein Coats in the Endomembrane System Cytosol AP-4 AP-1 AP-1 Plasma Endocytic membrane recycling Lysosome- domain 1 COPI compartment related (ERC) organelle (LRO) Tubular endosomal AP-3 network Sorting ER-Golgi (TEN) endosome intermediate AP-2 compartment COPII (ERGIC) AP-1 Retromer AP-4 AP-1 Trans-Golgi AP-5 Golgi network Endoplasmic complex (TGN) reticulum Late (ER) Plasma endosome/ membrane Lysosome multivesicular domain 2 body Adaptor Protein (AP) Complexes Lumen Membrane Cytosol µ1 σ1 µ2 σ2 µ3 σ3 µ4 σ4µ5 σ5 Core β1 γ β2 α β3 δ β4 ε β5 ζ Hinge Ear Adaptors AP-1 AP-2 AP-3 AP-4 AP-5 Coatopathies Lumen Membrane Cytosol µ1 σ1 µ2 σ2 µ3 σ3 µ4 σ4µ5 σ5 Core β1 γ β2 α β3 δ β4 ε β5 ζ Hinge Ear Adaptors AP-1 AP-2 AP-3 AP-4 AP-5 Diseases MEDNIK Hypocalciuric Hermansky- Hereditary Hereditary (coatopathies) syndrome hypercalcemia Pudlak spastic spastic (σ1A) type III syndrome paraplegia paraplegia (µ2) (HPS) type 2 (HSP) types type 48 (ζ) Fried/Pettigrew (β3A) and 47 (β4), 50 syndrome type 10 (δ) (µ4), 51 (ε) (σ1B) and 52 (σ4) Early onset Pustular epileptic psoriasis 15 encephalo (σ1C) pathy (EOEE) type 48 (β3B) Coatopathies Lumen Membrane Cytosol µ1 σ1 µ2 σ2 µ3 σ3 µ4 σ4µ5 σ5 Core β1 γ β2 α β3 δ β4 ε β5 ζ Hinge Ear Adaptors AP-1 AP-2 AP-3 AP-4 AP-5 Diseases MEDNIK Hypocalciuric Hermansky- Hereditary Hereditary (coatopathies) syndrome hypercalcemia Pudlak spastic spastic (σ1A) type III syndrome paraplegia paraplegia (µ2) (HPS) type 2 (HSP) types type 48 (ζ) Fried/Pettigrew (β3A) and 47 (β4), 50 syndrome type 10 (δ) (µ4), 51 (ε) (σ1B) and 52 (σ4) Early onset Pustular epileptic psoriasis 15 encephalo (σ1C) pathy (EOEE) type 48 (β3B) AP-3 Tyrosine-based Dileucine-based Endosomal Ear Membrane µ3A σ3A µ3B σ3B β3A β3A δ C Esteban Dell’Angelica What is the Physiological Role of AP-3? Tyrosine-based Dileucine-based Endosomal Ear Membrane µ3A σ3A µ3B σ3B β3A β3A δ C Esteban Dell’Angelica BLAST Search Identifies Garnet As Drosophila AP-3 δ >gi|24641854|ref|NP_524785.2| garnet CG10986-PB [Drosophila melanogaster] gi|22832217|gb|AAF48307.2| CG10986-PB [Drosophila melanogaster] Length = 1034 Score = 912 bits (2358), Expect = 0.0 Identities = 497/848 (58%), Positives = 609/848 (71%), Gaps = 49/848 (5%) Query: 1 MALKMVKGS-IDRMFDKNLQDLVRGIRNHKEDEAKYISQCIDEIKQELKQDNIAVKANAV 59 MALK VKG+ +RMFDKNL DLVRGIRN+K++EAKYIS CI+EIKQEL+QDNI+VK NAV Sbjct: 1 MALKKVKGNFFERMFDKNLTDLVRGIRNNKDNEAKYISTCIEEIKQELRQDNISVKCNAV 60 Query: 60 CKLTYLQMLGYDISWAAFNIIEVMSASKFTFKRIGYLAASQSFHEGTDVIMLTTNQIRKD 119 KLTY+QMLGYDISWA FNIIEVMS+S+FT KRIGYLAASQ FH ++++MLTTN IRKD Sbjct: 61 AKLTYIQMLGYDISWAGFNIIEVMSSSRFTCKRIGYLAASQCFHPDSELLMLTTNMIRKD 120 Query: 120 LSSPSQYDTGVALTGLSCFVTPDLARDLANDIMTLMSHTKPYIRKKAVLIMYKVFLKYPE 179 L+S +QYD GVAL+GLSCF++PDL+RDLANDIMTLMS TKPY+R KAVL+MYKVFL+YPE Sbjct: 121 LNSQNQYDAGVALSGLSCFISPDLSRDLANDIMTLMSSTKPYLRMKAVLMMYKVFLRYPE 180 Query: 180 SLRPAFPRLKEKLEDPDPGVQSAAVNVICELARRNPKNYLSLAPLFFKLMTSSTNNWVLI 239 +LRPAFP+LKEKLEDPDPGVQSAAVNVICELAR+NPKNYL LAP+FFKLMT+STNNW+LI Sbjct: 181 ALRPAFPKLKEKLEDPDPGVQSAAVNVICELARKNPKNYLPLAPIFFKLMTTSTNNWMLI 240 Query: 240 KIIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYECVNTVIAVLISLSSGMPNHSA 299 KIIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYEC+NTVIAVLIS+SSGMPNHSA Sbjct: 241 KIIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYECINTVIAVLISISSGMPNHSA 300 Chean Eng Ooi Drosophila Pigmentation Mutants Edith Wallace AP-3 Defects in Drosophila Pigmentation Mutants Tyrosine-based Dileucine-based Endosomal Ear Membrane Subunit Mutant µ3A σ3A µ3B σ3B δ garnet β3A β3A δ C Chean Eng Ooi, Chris Mullins AP-3 Defects in Drosophila Pigmentation Mutants Tyrosine-based Dileucine-based Endosomal Ear Membrane Subunit Mutant µ3A σ3A µ3B σ3B δ garnet β3A β3 ruby β δ 3A µ3 carmine σ3 orange C Chean Eng Ooi, Chris Mullins Sections of Wild-Type and Orange Eyes WT or Lisa Hartnell Could Mutations in AP-3 Cause Pigmentation Defects in Humans? Tyrosine-based Dileucine-based Endosomal Ear Membrane µ3A σ3A µ3B σ3B β3A β3A δ C Hermansky-Pudlak Syndrome (HPS) The Metabolic and Molecular Bases of Inherited Disease Hermansky-Pudlak Syndrome (HPS) Hermansky-Pudlak Syndrome (HPS) • Autosomal recessive disorder Hermansky-Pudlak Syndrome (HPS) • Autosomal recessive disorder • Oculocutaneous albinism Hermansky-Pudlak Syndrome (HPS) Hair and skin Iris Retina Hermansky-Pudlak Syndrome (HPS) • Autosomal recessive disorder • Oculocutaneous albinism Abnormal melanosomes Hermansky-Pudlak Syndrome (HPS) • Autosomal recessive disorder • Oculocutaneous albinism Abnormal melanosomes • Prolonged bleeding Absence of platelet dense granules Hermansky-Pudlak Syndrome (HPS) • Autosomal recessive disorder • Oculocutaneous albinism Abnormal melanosomes • Prolonged bleeding Absence of platelet dense granules • Fibrosis of the lungs, inflammatory colitis Hermansky-Pudlak Syndrome (HPS) • Autosomal recessive disorder • Oculocutaneous albinism Abnormal melanosomes • Prolonged bleeding Absence of platelet dense granules • Fibrosis of the lungs, inflammatory colitis Abnormal lung lamellar bodies, ceroid lipofucsin in macrophages William Gahl and Colleagues (NICHD/NHGRI) HPS Patients Photos Courtesy of Bill Gahl AP-3 Defects in HPS Fibroblasts Normal δ β3 σ3 Esteban Dell’Angelica AP-3 Defects in HPS Fibroblasts Normal Patient 8 δ β3 σ3 Esteban Dell’Angelica AP-3 Defects in HPS Fibroblasts Normal Patient 8 Patient 40 δ β3 σ3 Esteban Dell’Angelica AP-3 Defects in HPS Fibroblasts Normal Patient 8 Patient 40 δ β3 σ3 Esteban Dell’Angelica Mutations in β3A in HPS-2 Tyrosine-based Dileucine-based Endosomal Ear Membrane µ3A σ3A µ3B σ3B β3A β3B δ 1 642 809 1094 NH2 - T HE - COOH ∆390-410 L580R C Esteban Dell’Angelica Signal-Mediated Sorting of Tyrosinase by AP-3 Tyrosinase AP-3 Input L517,518A GST WT L527,528A AP-3 σ3 Lumen Cytosol José Martina, collaboration with Mickey Marks (U. Penn) AP-3 Sorts Tyrosinase to Melanosomes Cytosol Lysosome- Plasma Endocytic related membrane recycling organelle domain 1 compartment (LRO) (ERC) Tubular Tyrosinase endosomal AP-3 network Sorting ER-Golgi (TEN) endosome intermediate compartment (ERGIC) Trans-Golgi Golgi network Endoplasmic complex (TGN) reticulum Late (ER) Plasma endosome/ membrane Lysosome multivesicular domain 2 body Collaboration with Mickey Marks (U. Penn) Heterogeneity of HPS Photos Courtesy of Bill Gahl Human HPS Types HPS1 HPS2 HPS3 HPS4 HPS5 Photo Courtesy of Bill Gahl HPS6 HPS7 HPS8 HPS9 HPS10 Human and Mouse HPS Types HPS1 Pale ear HPS2 Pearl HPS3 Cocoa HPS4 Light ear HPS5 Ruby eye-2 Photo Courtesy of Bill Gahl HPS6 Ruby eye HPS7 Sandy HPS8 Reduced pigmentation HPS9 Muted HPS10 Mocha Cappuccino Pallid Subtle gray Gunmetal Biogenesis of Lysosome-Related Organelles Complexes (BLOCs) BLOC-1 BLOC-2 BLOS1 HPS3 BLOS2 HPS5 Snapin HPS6 Dysbindin Pallidin Muted BLOC-3 Cappuccino HPS1 BLOS3 HPS4 Kengo Moriyama, José Martina, Dell’Angelica lab, Swank lab, Spritz lab Biogenesis of Lysosome-Related Organelles Complexes (BLOCs) Cytosol Lysosome- Plasma Endocytic related membrane recycling organelle domain 1 compartment (LRO) (ERC) BLOC-3 Tubular BLOC-2 endosomal BLOC-1 network AP-3 Sorting ER-Golgi (TEN) endosome intermediate compartment (ERGIC) Trans-Golgi Golgi network Endoplasmic complex (TGN) reticulum Late (ER) Plasma endosome/ membrane Lysosome multivesicular domain 2 body BLOC-One-Related Complex (BORC) BLOC-1 BLOC-2 BORC BLOS1 HPS3 BLOS1 BLOS2 HPS5 BLOS2 Snapin HPS6 Snapin Dysbindin Myrlysin Pallidin Lyspersin Muted BLOC-3 Diaskedin Cappuccino HPS1 MEF2BNB BLOS3 HPS4 KXD1 Chris Schindler, Jing Pu BORC Couples Lysosomes and SVPs to Kinesins Lysosome PH Myr UDR CC3 BORC Arl8 FHA KIF1Bβ (-) (+) Microtubule Jing Pu, Charly Guardia BORC Couples Lysosomes and SVPs to Kinesins Lysosome SVP PH Myr UDR CC3 BORC Arl8 FHA KIF1Bβ (-) (+) Microtubule Jing Pu, Charly Guardia; Kang Shen’s lab at Stanford BORC Couples Lysosomes and SVPs to Kinesins Lysosome SVP PH Myr UDR CC3 BORC Arl8 FHA KIF1Bβ (-) (+) Microtubule BORCS7/Diaskedin: major schizophrenia susceptibility gene Jing Pu, Charly Guardia; Kang Shen’s lab at Stanford Does BLOC-1 Couple Melanosomal Carriers to Kinesin? Melanosome Endosomal tubule BLOC-1 Lysosome GTPase? SVP PH Kinesin? Myr UDR CC3 BORC Arl8 FHA (-) (+) Microtubule KIF1Bβ (-) (+) Microtubule Jing Pu, Charly Guardia; Kang Shen’s lab at Stanford Graça Raposo, Mickey

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    60 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us