
NR3C1 antibody - N-terminal region (ARP31090_P050) Data Sheet Product Number ARP31090_P050 Product Name NR3C1 antibody - N-terminal region (ARP31090_P050) Size 50ug Gene Symbol NR3C1 Alias Symbols GCCR; GCR; GR; GRL Nucleotide Accession# NM_001018076 Protein Size (# AA) 777 amino acids Molecular Weight 86kDa Product Format Lyophilized powder NCBI Gene Id 2908 Host Rabbit Clonality Polyclonal Official Gene Full Name Nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) Gene Family NR This is a rabbit polyclonal antibody against NR3C1. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAV NR3C1 is a receptor for glucocorticoids that can act as both a transcription factor and as a regulator of other transcription factors. This protein can also be found in heteromeric cytoplasmic complexes along with heat Description of Target shock factors and immunophilins. The protein is typically found in the cytoplasm until it binds a ligand, which induces transport into the nucleus. Mutations in this gene are a cause of glucocorticoid resistance, or cortisol, resistance. KDM5A, NCOA2, TP53, ADA, AR, BAG1, CALM1, CALR, CEBPA, CEBPB, CHD9, COPS6, CREB1, CREBBP, DAP3, DCAF6, DDX54, ECD, ETS1, ETS2, FKBP4, FYN, GRIP1, HNRNPU, HSP90AA1, HSPA1A, IDE, IFNGR2, JUN, KDM5A, KPNA2, LCK, MAPK1, MAPK15, MAPK8, MDM2, MED14, NCL, NCOA1, NCOA2, NCOA6, NCOR1, NCOR2, NFKB1, NFKB2, NR2F2, NR2F6, NR3C1, NR3C2, NRIP1, ONECUT1, PBX1, POU1F1, POU2F1, POU2F2, PPARGC1A, PRKACA, PRKDC, PSMC3IP, PTGES3, PTMS, RAF1, RELA, RNF14, SFN, SLC25A4, SMAD3, SMARCA2, SMARCA4, SMARCB1, SMARCC1, SMARCD1, SMARCE1, STAT3, STAT5A, STAT5B, SUMO1, SUMO4, SYT1, TBP, TGFB1I1, TP53, TRIM24, Partner Proteins TRIM28, TSG101, TXN, UBB, UBE2I, YWHAH, ZBTB16, ADA, ARPC5, BAG1, CALR, CEBPA, CEBPB, CREB1, CREBBP, DAP3, DAXX, DDX54, ECD, EP300, ETS2, FKBP4, GRIP1, HDAC1, HDAC2, HMGB1, HMGB2, HNRNPU, HOXB1, HSP82, HSP90AA1, HSPA1A, HSPD1, JUN, KDM5A, LRIF1, MAFF, MDM2, MED1, MED14, MSX2, NCL, NCOA1, NCOA2, NCOA3, NCOA4, NCOA6, NCOR1, NCOR2, NEDD4L, NFKB1, NFKB2, NR2E3, NR2F2, NR2F6, NR3C1, NR3C2, NRIP1, ONECUT1, PBX1, PIAS2, PML, POU1F1, POU2F1, POU2F2, PPARGC1A, PSMC3IP, PTGES3, PTMS, Psmc3ip, RAD9A, RAF1, RAN, RANBP9, RBM14, RELA, RXRB, SET, SFN, SFPQ, SMAD3, SMARCA2, SMARCA4, SMARCC1, SMARCD1, SMARCE1, SRC, STAT3, STAT5B, SVIL, TADA2A, TBP, TDG, TGFB1I1, TP53, TRIM24, TRIM28, TSG101, TXN, UBC, YWHAH, ZBTB16, ZBTB20, ZBTB3, ZBTB9, ZNF496 Reconstitution and Add 50 ul of distilled water. Final anti-NR3C1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-NR3C1 antibody is Catalog # AAP31090 Immunogen The immunogen for anti-NR3C1 antibody: synthetic peptide directed towards the N terminal of human NR3C1 Swissprot Id P04150 Protein Name Glucocorticoid receptor Protein Accession # NP_001018086 Purification Affinity Purified Species Reactivity Human, Rabbit, Rat, Sheep, Mouse, Bovine, Pig, Horse Application WB Predicted Homology Based on Immunogen Human: 100%; Rat: 86%; Rabbit: 86%; Pig: 79%; Horse: 79%; Mouse: 79%; Sheep: 79%; Bovine: 79% Sequence Human HepG2 WB Suggested Anti-NR3C1 Antibody Image 1 Titration: 1.0 ug/ml Positive Control: HepG2 Whole Cell __________________________________________________________________________________________________________________________________________________________________ This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users..
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-