MRPS25 (NM 022497) Human Tagged ORF Clone – RC201353

MRPS25 (NM 022497) Human Tagged ORF Clone – RC201353

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC201353 MRPS25 (NM_022497) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: MRPS25 (NM_022497) Human Tagged ORF Clone Tag: Myc-DDK Symbol: MRPS25 Synonyms: COXPD50; MRP-S25; RPMS25 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC201353 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCATGAAGGGCCGCTTCCCCATCCGCCGCACCCTGCAATATCTGAGCCAGGGGAACGTGGTGTTCA AGGACTCCGTGAAGGTCATGACAGTGAATTACAACACGCATGGGGAGCTGGGCGAGGGCGCCAGGAAGTT TGTGTTTTTCAACATACCTCAGATTCAATACAAAAACCCTTGGGTGCAGATCATGATGTTTAAGAACATG ACGCCGTCACCCTTCCTGCGATTCTACTTAGATTCTGGGGAGCAGGTCCTGGTGGATGTGGAGACCAAGA GCAATAAGGAGATCATGGAGCACATCAGAAAAATCTTGGGGAAGAATGAGGAAACCCTCAGGGAAGAGGA GGAGGAGAAAAAGCAGCTTTCTCACCCAGCCAACTTCGGCCCTCGAAAGTACTGCCTGCGGGAGTGCATC TGTGAAGTGGAAGGGCAGGTGCCCTGCCCCAGCCTGGTGCCATTACCCAAGGAGATGAGGGGGAAGTACA AAGCCGCTCTGAAAGCCGATGCCCAGGAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC201353 protein sequence Red=Cloning site Green=Tags(s) MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNM TPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECI CEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6393_f06.zip This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 MRPS25 (NM_022497) Human Tagged ORF Clone – RC201353 Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_022497 ORF Size: 519 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_022497.5 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 MRPS25 (NM_022497) Human Tagged ORF Clone – RC201353 RefSeq Size: 4574 bp RefSeq ORF: 522 bp Locus ID: 64432 UniProt ID: P82663 Domains: L51_S25_CI-B8 MW: 20.1 kDa Gene Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. A pseudogene corresponding to this gene is found on chromosome 4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] Product images: Western blot validation of overexpression lysate (Cat# [LY411645]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC201353 using transfection reagent MegaTran 2.0 (Cat# [TT210002]). Coomassie blue staining of purified MRPS25 protein (Cat# [TP301353]). The protein was produced from HEK293T cells transfected with MRPS25 cDNA clone (Cat# RC201353) using MegaTran 2.0 (Cat# [TT210002]). This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us