LRDD purified MaxPab mouse page for detailed protocols polyclonal antibody (B01P) Storage Buffer: In 1x PBS, pH 7.4 Catalog Number: H00055367-B01P Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Regulatory Status: For research use only (RUO) Entrez GeneID: 55367 Product Description: Mouse polyclonal antibody raised against a full-length human LRDD protein. Gene Symbol: LRDD Immunogen: LRDD (ABW03662.1, 1 a.a. ~ 893 a.a) Gene Alias: DKFZp434D229, MGC16925, PIDD full-length human protein. Gene Summary: The protein encoded by this gene Sequence: contains a leucine-rich repeat and a death domain. This MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGN protein has been shown to interact with other death RLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLSTHE domain proteins, such as Fas (TNFRSF6)-associated via DPQLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACL death domain (FADD) and MAP-kinase activating death RGALTNLPAGLSGLAHLAHLDLSFNSLETLPACVLQMR domain-containing protein (MADD), and thus may GLGALLLSHNCLSELPEALGALPALTFLTVTHNRLQTLP function as an adaptor protein in cell death-related PALGALSTLQRLDLSQNLLDTLPPEIGGLGSLLELNLAS signaling processes. The expression of the mouse NRLQSLPASLAGLRSLRLLVLHSNLLASVPADLARLPLL counterpart of this gene has been found to be positively TRLDLRDNQLRDLPPELLDAPFVRLQGNPLGEASPDA regulated by the tumor suppressor p53 and to induce PSSPVAALIPEMPRLFLTSDLDSFPVTPRGCSVTLACG cell apoptosis in response to DNA damage, which VRLQFPAGATATPITIRYRLLLPEPGLVPLGPHDALLSH suggests a role for this gene as an effector of VLELQPHGVAFQQDVGLWLLFTPPQARRCREVVVRT p53-dependent apoptosis. Three alternatively spliced RNDNSWGDLETYLEEEAPQRLWAHCQVPHFSWFLVV transcript variants encoding distinct isoforms have been SRPVSNACLVPPEGTLLCSSGHPGVKVIFPPGATEEP reported. [provided by RefSeq] RRVSMQVVRMAGRELQALLGEPEAAVSPLLCLSQSG PPSFLQPVTVQLPLPSGITGLSLDRSRLHLLYWAPPAA TWDDITAQVVLELTHLYARFQVTHFSWYWLWYTTKNC VGGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLP RNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFE RGIDVDADRPDCVEGRICFVFYSHLKNVKEVSFYRGA VPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSE GPRRGAGLSLAPLNLGDAETGFLTQSNLLSVAGRLGL DWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFS WAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLE LGRRKYQDSIRRMGLAPKDPALPGSSAPQPPEPAQA Host: Mouse Reactivity: Human Applications: WB-Tr (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product Page 1/1 Powered by TCPDF (www.tcpdf.org).