TMED1 (NM 006858) Human Tagged ORF Clone – RC200255

TMED1 (NM 006858) Human Tagged ORF Clone – RC200255

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC200255 TMED1 (NM_006858) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: TMED1 (NM_006858) Human Tagged ORF Clone Tag: Myc-DDK Symbol: TMED1 Synonyms: Il1rl1l; IL1RL1LG; p24g1; Tp24 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC200255 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATGGCGGCCGGCGCGGCCCTAGCCCTGGCCTTGTGGCTACTAATGCCACCAGTGGAGGTGGGAGGGG CGGGGCCCCCGCCAATCCAGGACGGTGAGTTCACGTTCCTGTTGCCGGCGGGGAGGAAGCAGTGTTTCTA CCAGTCCGCGCCGGCCAACGCAAGCCTCGAGACCGAATACCAGGTGATCGGAGGTGCTGGACTGGACGTG GACTTCACGCTGGAGAGCCCTCAGGGCGTGCTGTTGGTCAGCGAGTCCCGCAAGGCTGATGGGGTACACA CGGTGGAGCCAACGGAGGCCGGGGACTACAAGCTGTGCTTTGACAACTCCTTCAGCACCATCTCCGAGAA GCTGGTGTTCTTTGAACTGATCTTTGACAGCCTCCAGGATGACGAGGAGGTCGAAGGATGGGCAGAGGCT GTGGAGCCCGAGGAGATGCTGGATGTTAAAATGGAGGACATCAAGGAGTCCATTGAGACCATGCGGACCC GGCTGGAGCGCAGCATCCAGATGCTCACGCTACTGCGGGCCTTCGAGGCACGTGACCGCAACCTGCAAGA GGGCAACTTGGAGCGGGTCAACTTCTGGTCAGCTGTCAACGTGGCGGTGCTGCTGCTGGTGGCTGTGCTG CAGGTCTGCACGCTCAAGCGCTTCTTCCAGGACAAGCGCCCGGTGCCCACG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 4 TMED1 (NM_006858) Human Tagged ORF Clone – RC200255 Protein Sequence: >RC200255 protein sequence Red=Cloning site Green=Tags(s) MMAAGAALALALWLLMPPVEVGGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDV DFTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFFELIFDSLQDDEEVEGWAEA VEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEGNLERVNFWSAVNVAVLLLVAVL QVCTLKRFFQDKRPVPT myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6128_e01.zip Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_006858 ORF Size: 681 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 4 TMED1 (NM_006858) Human Tagged ORF Clone – RC200255 OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_006858.4 RefSeq Size: 1739 bp RefSeq ORF: 684 bp Locus ID: 11018 UniProt ID: Q13445 Protein Families: Druggable Genome, Transmembrane MW: 25.2 kDa Gene Summary: This gene belongs to the TMED (transmembrane emp24 domain-containing) protein family, which is involved in the vesicular trafficking of proteins. The protein encoded by this gene was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1) and may play a role in innate immunity. This protein lacks any similarity to other interleukin 1 ligands. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013] Product images: HEK293T cells were transfected with the pCMV6- ENTRY control (Cat# [PS100001], Left lane) or pCMV6-ENTRY TMED1 (Cat# RC200255, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-TMED1(Cat# [TA503620]). Positive lysates [LY402049] (100ug) and [LC402049] (20ug) can be purchased separately from OriGene. This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 4 TMED1 (NM_006858) Human Tagged ORF Clone – RC200255 Western blot validation of overexpression lysate (Cat# [LY402049]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200255 using transfection reagent MegaTran 2.0 (Cat# [TT210002]). This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 4 / 4.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    4 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us