
Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic CYP4F22 (Human) Recombinant repeated freezing and thawing. Protein (P01) Entrez GeneID: 126410 Catalog Number: H00126410-P01 Gene Symbol: CYP4F22 Regulation Status: For research use only (RUO) Gene Alias: FLJ39501, LI3 Product Description: Human CYP4F22 full-length ORF Gene Summary: This gene encodes a member of the ( AAH69351.1, 1 a.a. - 531 a.a.) recombinant protein cytochrome P450 superfamily of enzymes. The with GST-tag at N-terminal. cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism Sequence: and synthesis of cholesterol, steroids and other lipids. MLPITDRLLHLLGLEKTAFRIYAVSTLLLFLLFFLFRLLLR This gene is part of a cluster of cytochrome P450 genes FLRLCRSFYITCRRLRCFPQPPRRNWLLGHLGMYLPN on chromosome 19 and encodes an enzyme thought to EAGLQDEKKVLDNMHHVLLVWMGPVLPLLVLVHPDYI play a role in the 12(R)-lipoxygenase pathway. Mutations KPLLGASAAIAPKDDLFYGFLKPWLGDGLLLSKGDKW in this gene are the cause of ichthyosis lamellar type 3. SRHRRLLTPAFHFDILKPYMKIFNQSADIMHAKWRHLA [provided by RefSeq] EGSAVSLDMFEHISLMTLDSLQKCVFSYNSNCQEKMS DYISAIIELSALSVRRQYRLHHYLDFIYYRSADGRRFRQ ACDMVHHFTTEVIQERRRALRQQGAEAWLKAKQGKT LDFIDVLLLARDEDGKELSDEDIRAEADTFMFEGHDTT SSGISWMLFNLAKYPEYQEKCREEIQEVMKGRELEEL EWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKL PDGRIIPKGIICLVSIYGTHHNPTVWPDSKVYNPYRFDP DNPQQRSPLAYVPFSAGPRNCIGQSFAMAELRVVVAL TLLRFRLSVDRTRKVRRKPELILRTENGLWLKVEPLPP RA Host: Wheat Germ (in vitro) Theoretical MW (kDa): 88.4 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-