TSPAN7 (Human) Recombinant Gene Symbol: TSPAN7 Protein Gene Alias: A15, CCG-B7, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2, TM4SF2b Catalog Number: H00007102-G01 Gene Summary: The protein encoded by this gene is a Regulation Status: For research use only (RUO) member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members Product Description: Human TSPAN7 full-length ORF are cell-surface proteins that are characterized by the (NP_004606.2) recombinant protein without tag. presence of four hydrophobic domains. The proteins Sequence: mediate signal transduction events that play a role in the MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVW regulation of cell development, activation, growth and GKLTLGTYISLIAENSTNAPYVLIGTGTTIVVFGLFGCFA motility. This encoded protein is a cell surface TCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIK glycoprotein and may have a role in the control of neurite DTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGV outgrowth. It is known to complex with integrins. This QNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLT gene is associated with X-linked mental retardation and VAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLI neuropsychiatric diseases such as Huntington's chorea, GMLLACCLSRFITANQYEMV fragile X syndrome and myotonic dystrophy. [provided by RefSeq] Host: Wheat Germ (in vitro) Theoretical MW (kDa): 27.6 Applications: AP (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Liquid Preparation Method: in vitro wheat germ expression system with proprietary liposome technology Purification: None Recommend Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 7102 Page 1/1 Powered by TCPDF (www.tcpdf.org).