OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA338769 KChIP2 (KCNIP2) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2. Synthetic peptide located within the following region: ALAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKE Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Concentration: lot specific Purification: Protein A purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 32 kDa Gene Name: potassium voltage-gated channel interacting protein 2 Database Link: NP_055406 Entrez Gene 30819 Human Q9NS61 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 KChIP2 (KCNIP2) Rabbit Polyclonal Antibody – TA338769 Background: This gene encodes a member of the family of voltage-gated potassium (Kv) channel- interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. [provided by RefSeq, Jul 2008] Synonyms: KCHIP2 Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 86% Protein Families: Druggable Genome, Ion Channels: Other Product images: Lanes: ; Lane 1: 20ug HEK-293 cell lysate; Lane 2: 20ug mkchIP2-YFP transfected HEK-293 lysate; Lane 3: 20ug mkchIP3-YFP transfected HEK-293 lysate; Lane 4: 20ug mkchIP4-YFP transfected HEK-293 lysate; Primary Antibody Dilution: ; 1:1000; Secondary Antibo This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 KChIP2 (KCNIP2) Rabbit Polyclonal Antibody – TA338769 Host: Rabbit; Target Name: KCNIP2; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml WB Suggested Anti-KCNIP2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate KCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat Host: Rabbit; Target Name: KCNIP2; Sample Tissue: Human Jurkat; Antibody Dilution: 1.0 ug/ml; KCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.