CRYGB (NM 005210) Human Tagged ORF Clone – RC214533

CRYGB (NM 005210) Human Tagged ORF Clone – RC214533

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC214533 CRYGB (NM_005210) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: CRYGB (NM_005210) Human Tagged ORF Clone Tag: Myc-DDK Symbol: CRYGB Synonyms: CRYG2; CTRCT39 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC214533 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGAAAGATCACCTTCTACGAGGACAGGGCCTTCCAGGGCCGCAGCTACGAATGCACCACTGACTGCC CCAACCTACAACCCTATTTCAGCCGCTGCAACTCCATCAGGGTGGAGAGCGGCTGCTGGATGATCTATGA GCGCCCCAACTACCAGGGCCACCAGTACTTCCTGCGGCGTGGGGAGTACCCCGACTACCAGCAATGGATG GGCCTCAGCGACTCCATCCGCTCCTGCTGCCTCATCCCCCCGCACTCTGGCGCTTACAGAATGAAGATCT ACGACAGAGATGAATTGAGGGGACAAATGTCAGAGCTCACAGACGACTGTCTCTCTGTTCAGGACCGCTT CCACCTCACTGAAATTCACTCCCTCAATGTGCTGGAGGGCAGCTGGATCCTCTATGAGATGCCCAACTAC AGGGGGAGGCAGTATCTGCTGAGGCCGGGGGAGTACAGGAGGTTTCTTGATTGGGGGGCTCCAAATGCCA AAGTTGGCTCTCTTAGACGAGTCATGGATTTGTAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC214533 protein sequence Red=Cloning site Green=Tags(s) MGKITFYEDRAFQGRSYECTTDCPNLQPYFSRCNSIRVESGCWMIYERPNYQGHQYFLRRGEYPDYQQWM GLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCLSVQDRFHLTEIHSLNVLEGSWILYEMPNY RGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6463_a08.zip This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 4 CRYGB (NM_005210) Human Tagged ORF Clone – RC214533 Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_005210 ORF Size: 525 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_005210.2, NP_005201.1 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 4 CRYGB (NM_005210) Human Tagged ORF Clone – RC214533 RefSeq Size: 643 bp RefSeq ORF: 528 bp Locus ID: 1419 UniProt ID: P07316 Protein Families: Druggable Genome MW: 20.9 kDa Gene Summary: Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma- D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. [provided by RefSeq, Jul 2008] Product images: Western blot validation of overexpression lysate (Cat# [LY417447]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC214533 using transfection reagent MegaTran 2.0 (Cat# [TT210002]). This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 4 CRYGB (NM_005210) Human Tagged ORF Clone – RC214533 Coomassie blue staining of purified CRYGB protein (Cat# [TP314533]). The protein was produced from HEK293T cells transfected with CRYGB cDNA clone (Cat# RC214533) using MegaTran 2.0 (Cat# [TT210002]). This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 4 / 4.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    4 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us