
MMP2 (Human) Recombinant protein (< 1 EU/ug). Protein Activity: MMP-2 activity was measured by its ability to cleave a chromogenic peptide MMP-2 substrate at room Catalog Number: P6073 temperature. At an MMP-2 concentration of 2.5 ug/ml, Regulation Status: For research use only (RUO) 50% cleavage was achieved at an incubation time of approximately 25 minutes. Product Description: Human MMP2 (P08253) partial recombinant protein expressed in Escherichia coli. Recommend Usage: Activity assay SDS-PAGE Sequence: The optimal working dilution should be determined by MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFAR the end user. AFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYP FDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQ Storage Buffer: Lyophilized from 0.4x PBS, pH 7.4. VVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDG Storage Instruction: Store at -20°C. FLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPC Reconstitute in water to a concentration of 0.1-1.0 KFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDK mg/mL. Do not vortex. KYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCT For extended storage, it is recommended to further dilute SAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFL in buffer containing carrier protein (e.g. 0.1% BSA) and VAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQD store in aliquots at -20°C to -80°C is recommended. DIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVF DGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFW Entrez GeneID: 4313 PELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERG YPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKF Gene Symbol: MMP2 WRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQG GGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC Gene Alias: CLG4, CLG4A, MMP-II, MONA, TBE-1 Host: Escherichia coli Gene Summary: Proteins of the matrix metalloproteinase (MMP) family are involved in the Theoretical MW (kDa): 62.0 breakdown of extracellular matrix in normal physiological processes, such as embryonic development, Reactivity: Human reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Applications: Func, SDS-PAGE Most MMP's are secreted as inactive proproteins which (See our web site product page for detailed applications are activated when cleaved by extracellular proteinases. information) This gene encodes an enzyme which degrades type IV Protocols: See our web site at collagen, the major structural component of basement http://www.abnova.com/support/protocols.asp or product membranes. The enzyme plays a role in endometrial page for detailed protocols menstrual breakdown, regulation of vascularization and the inflammatory response. Mutations in this gene have Form: Lyophlized been associated with Winchester syndrome and Nodulosis-Arthropathy-Osteolysis (NAO) syndrome. Two Preparation Method: Escherichia coli expression transcript variants encoding different isoforms have been system found for this gene. [provided by RefSeq] Purity: 90% Endotoxin Level: Endotoxin level is < 0.1 ng/ug of Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages1 Page
-
File Size-