POLR1D (NM 001206559) Human Tagged ORF Clone Product Data

POLR1D (NM 001206559) Human Tagged ORF Clone Product Data

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC231609 POLR1D (NM_001206559) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: POLR1D (NM_001206559) Human Tagged ORF Clone Tag: Myc-DDK Symbol: POLR1D Synonyms: AC19; POLR1C; RPA9; RPA16; RPAC2; RPC16; RPO1-3; TCS2 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC231609 representing NM_001206559 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGACCCATGGGTTGGATGAAGTGTCCTCTTGCTAGCACCAATAAAAGATTTCTAATTAACACAATTA AAAACACATTGCCCTCTCATAAAGAGCAAGACCATGAACAAAAAGAGGGCGATAAGGAACCAGCGAAGAG CCAGGCCCAGAAAGAAGAAAACCCGAAGAAACACAGAAGCCATCCTTACAAGCACAGCTTCCGCGCTCGA GGTTCCGCCAGTTACTCCCCGCCACGAAAGCGGAGCAGCCAGGACAAGTACGAAAAGCGGTCCAACCGGC GG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC231609 representing NM_001206559 Red=Cloning site Green=Tags(s) MGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRAR GSASYSPPRKRSSQDKYEKRSNRR myc-FLAG tag Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 POLR1D (NM_001206559) Human Tagged ORF Clone – RC231609 Cloning Scheme: Plasmid Map: ACCN: NM_001206559 ORF Size: 282 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 POLR1D (NM_001206559) Human Tagged ORF Clone – RC231609 OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_001206559.2 RefSeq Size: 2210 bp RefSeq ORF: 285 bp Locus ID: 51082 UniProt ID: P0DPB5, A0A087WTY1 Protein Families: Stem cell - Pluripotency, Transcription Factors Protein Pathways: Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase MW: 11.5 kDa Gene Summary: The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2011] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us