SFRS12 (SREK1) Rabbit Polyclonal Antibody – TA339981 | Origene

SFRS12 (SREK1) Rabbit Polyclonal Antibody – TA339981 | Origene

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA339981 SFRS12 (SREK1) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-SFRS12 antibody: synthetic peptide directed towards the N terminal of human SFRS12. Synthetic peptide located within the following region: DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSLLAPAPTMTSL Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Concentration: lot specific Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 72 kDa Gene Name: splicing regulatory glutamic acid/lysine-rich protein 1 Database Link: NP_001070667 Entrez Gene 140890 Human Q8WXA9 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 SFRS12 (SREK1) Rabbit Polyclonal Antibody – TA339981 Background: SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins.SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins (Barnard et al., 2002 [PubMed 11991645]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-78 AW963850.1 1-78 79-415 AK091758.1 1-337 416-2238 BC067770.1 609-2431 2239-3654 BC112343.1 1800-3215 3655-3660 AK125893.1 3379-3384 3661-4030 AL049309.1 705-1074 Synonyms: SFRS12; SRrp86; SRrp508 Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 92%; Zebrafish: 92% Product images: WB Suggested Anti-SFRS12 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: HT1080 cell lysate SREK1 is supported by BioGPS gene expression data to be expressed in HT1080 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 2.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    2 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us