EB2 (MAPRE2) (NM 014268) Human Tagged ORF Clone Product Data

EB2 (MAPRE2) (NM 014268) Human Tagged ORF Clone Product Data

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC200259 EB2 (MAPRE2) (NM_014268) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: EB2 (MAPRE2) (NM_014268) Human Tagged ORF Clone Tag: Myc-DDK Symbol: MAPRE2 Synonyms: CSCSC2; EB1; EB2; RP1 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC200259 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCTGGGCCGACCCAAACCCTGTCCCCAAATGGCGAGAACAACAACGACATCATCCAGGATAATAACG GGACCATCATTCCTTTCCGGAAGCACACAGTGCGCGGGGAGCGTTCCTACAGTTGGGGAATGGCGGTCAA TGTGTATTCTACCTCGATAACCCAAGAGACTATGAGCAGACATGACATCATTGCATGGGTTAATGACATA GTATCTTTAAACTACACAAAAGTGGAACAGCTTTGTTCAGGAGCGGCCTATTGCCAATTCATGGACATGC TCTTCCCTGGCTGCATTAGTTTGAAGAAAGTAAAATTTCAAGCAAAGCTGGAACATGAATATATTCACAA TTTTAAACTTCTGCAAGCATCATTTAAGCGAATGAACGTTGATAAGGTAATTCCAGTGGAGAAGCTAGTG AAAGGACGTTTCCAGGACAACCTGGATTTTATTCAATGGTTTAAGAAATTCTATGATGCTAACTACGATG GGAAGGAGTATGATCCTGTAGAGGCACGACAAGGGCAAGATGCAATTCCTCCTCCTGACCCTGGTGAACA GATCTTCAACCTGCCAAAAAAGTCTCACCATGCAAACTCCCCCACAGCAGGTGCAGCTAAATCAAGTCCA GCAGCTAAACCAGGATCCACACCTTCTCGACCCTCATCAGCCAAAAGGGCTTCTTCCAGTGGCTCAGCAT CCAAATCCGATAAAGATTTAGAAACGCAGGTCATACAGCTTAATGAACAGGTACATTCATTAAAACTTGC CCTTGAAGGCGTGGAAAAGGAAAGGGATTTCTACTTTGGGAAGTTGAGAGAGATCGAGCTACTCTGCCAA GAACACGGGCAGGAAAATGATGACCTCGTGCAGAGACTAATGGACATCCTGTATGCTTCAGAAGAACACG AGGGCCACACAGAAGAGCCGGAAGCAGAGGAGCAAGCCCACGAACAGCAGCCCCCGCAGCAGGAAGAGTA C ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 4 EB2 (MAPRE2) (NM_014268) Human Tagged ORF Clone – RC200259 Protein Sequence: >RC200259 protein sequence Red=Cloning site Green=Tags(s) MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDI VSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLV KGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSP AAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQ EHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6381_b12.zip Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_014268 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 4 EB2 (MAPRE2) (NM_014268) Human Tagged ORF Clone – RC200259 ORF Size: 981 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_014268.4 RefSeq Size: 4279 bp RefSeq ORF: 984 bp Locus ID: 10982 UniProt ID: Q15555, A0A024RC33 Domains: CH, EB1 Protein Families: Druggable Genome MW: 37 kDa Gene Summary: The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. This protein is a microtubule-associated protein that is necessary for spindle symmetry during mitosis. It is thought to play a role in the tumorigenesis of colorectal cancers and the proliferative control of normal cells. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012] Product images: HEK293T cells were transfected with the pCMV6- ENTRY control (Cat# [PS100001], Left lane) or pCMV6-ENTRY MAPRE2 (Cat# RC200259, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MAPRE2(Cat# [TA502928]). Positive lysates [LY415395] (100ug) and [LC415395] (20ug) can be purchased separately from OriGene. This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 4 EB2 (MAPRE2) (NM_014268) Human Tagged ORF Clone – RC200259 Western blot validation of overexpression lysate (Cat# [LY415395]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200259 using transfection reagent MegaTran 2.0 (Cat# [TT210002]). Coomassie blue staining of purified MAPRE2 protein (Cat# [TP300259]). The protein was produced from HEK293T cells transfected with MAPRE2 cDNA clone (Cat# RC200259) using MegaTran 2.0 (Cat# [TT210002]). This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 4 / 4.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    4 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us