![DDX50 Maxpab Mouse Polyclonal Antibody (B01)](https://data.docslib.org/img/3a60ab92a6e30910dab9bd827208bcff-1.webp)
DDX50 MaxPab mouse polyclonal Storage Instruction: Store at -20°C or lower. Aliquot to antibody (B01) avoid repeated freezing and thawing. Entrez GeneID: 79009 Catalog Number: H00079009-B01 Gene Symbol: DDX50 Regulatory Status: For research use only (RUO) Gene Alias: GU2, GUB, MGC3199, RH-II/GuB Product Description: Mouse polyclonal antibody raised against a full-length human DDX50 protein. Gene Summary: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are Immunogen: DDX50 (NP_076950.1, 1 a.a. ~ 737 a.a) putative RNA helicases. They are implicated in a number full-length human protein. of cellular processes involving alteration of RNA Sequence: secondary structure such as translation initiation, nuclear MPGKLLWGDIMELEAPLEESESQKKERQKSDRRKSR and mitochondrial splicing, and ribosome and HHYDSDEKSETRENGVTDDLDAPKAKKSKMKEKLNG spliceosome assembly. Based on their distribution DTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSK patterns, some members of this DEAD box protein family RVSSLDTSTHKSSDNKLEETLTREQKEGAFSNFPISEE are believed to be involved in embryogenesis, TIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTG spermatogenesis, and cellular growth and division. This KTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELAN gene encodes a DEAD box enzyme that may be QVAKDFKDITRKLSVACFYGGTSYQSQINHIRNGIDILV involved in ribosomal RNA synthesis or processing. This GTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGFA gene and DDX21, also called RH-II/GuA, have similar EQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAKK genomic structures and are in tandem orientation on YMKSRYEQVDLVGKMTQKAATTVEHLAIQCHWSQRP chromosome 10, suggesting that the two genes arose by AVIGDVLQVYSGSEGRAIIFCETKKNVTEMAMNPHIKQ gene duplication in evolution. This gene has NAQCLHGDIAQSQREITLKGFREGSFKVLVATNVAAR pseudogenes on chromosomes 2, 3 and 4. Alternative GLDIPEVDLVIQSSPPQDVESYIHRSGRTGRAGRTGICI splicing of this gene generates multiple transcript CFYQPRERGQLRYVEQKAGITFKRVGVPSTMDLVKSK variants, but the full length nature of all the other variants SMDAIRSLASVSYAAVDFFRPSAQRLIEEKGAVDALAA but one has not been defined. [provided by RefSeq] ALAHISGASSFEPRSLITSDKGFVTMTLESLEEIQDVSC AWKELNRKLSSNAVSQITRMCLLKGNMGVCFDVPTTE SERLQAEWHDSDWILSVPAKLPEIEEYYDGNTSSNSR QRSGWSSGRSGRSGRSGGRSGGRSGRQSRQGSRS GSRQDGRRRSGNRNRSRSGGHKRSFD Host: Mouse Reactivity: Human Applications: IF, WB-Tr (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Storage Buffer: No additive Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages1 Page
-
File Size-