ARL8B (NM 018184) Human Tagged ORF Clone Product Data

ARL8B (NM 018184) Human Tagged ORF Clone Product Data

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG209368 ARL8B (NM_018184) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: ARL8B (NM_018184) Human Tagged ORF Clone Tag: TurboGFP Symbol: ARL8B Synonyms: ARL10C; Gie1 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG209368 representing NM_018184 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCTGGCGCTCATCTCCCGCCTGCTGGACTGGTTCCGTTCGCTCTTCTGGAAGGAAGAGATGGAGCTGA CGCTCGTGGGGCTGCAGTACTCGGGCAAGACCACCTTCGTCAATGTCATCGCGTCAGGTCAATTCAGTGA AGATATGATACCCACAGTGGGCTTCAACATGAGGAAGGTAACTAAAGGTAACGTCACAATAAAGATCTGG GACATAGGAGGACAACCCCGATTTCGAAGCATGTGGGAGCGGTATTGCAGAGGAGTCAATGCTATTGTTT ACATGATAGATGCTGCAGATCGTGAAAAGATAGAAGCTTCCCGAAATGAGCTACATAATCTTCTAGATAA ACCACAGTTACAAGGAATTCCAGTGCTAGTGCTTGGAAACAAGAGAGATCTTCCTAATGCCTTGGATGAG AAACAGCTAATTGAAAAAATGAATCTGTCTGCTATTCAGGATAGAGAAATTTGCTGCTATTCAATTTCTT GCAAAGAAAAGGATAATATAGATATCACACTTCAGTGGCTTATTCAGCATTCAAAATCTAGAAGAAGC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >RG209368 representing NM_018184 Red=Cloning site Green=Tags(s) MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIW DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDE KQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 ARL8B (NM_018184) Human Tagged ORF Clone – RG209368 Cloning Scheme: Plasmid Map: ACCN: NM_018184 ORF Size: 558 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 ARL8B (NM_018184) Human Tagged ORF Clone – RG209368 RefSeq: NM_018184.3 RefSeq Size: 3008 bp RefSeq ORF: 561 bp Locus ID: 55207 UniProt ID: Q9NVJ2 Domains: RAB, SAR, ARF, arf Gene Summary: Plays a role in lysosome motility (PubMed:16537643, PubMed:25898167). In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (By similarity). May play a role in chromosome segregation (PubMed:15331635).[UniProtKB/Swiss-Prot Function] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us