Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic RAB2B (Human) Recombinant Ras superfamily that contain 4 highly conserved regions Protein (P01) involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in Catalog Number: H00084932-P01 vesicular fusion and trafficking; see MIM 179508.[supplied by OMIM] Regulation Status: For research use only (RUO) Product Description: Human RAB2B full-length ORF ( NP_116235.2, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. Sequence: MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTI GVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSYYR GAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVI MLIGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKT ACNVEEAFINTAKEIYRKIQQGLFDVHNEANGIKIGPQQ SISTSVGPSASQRNSRDIGSNSGCC Host: Wheat Germ (in vitro) Theoretical MW (kDa): 50.6 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 84932 Gene Symbol: RAB2B Gene Alias: FLJ14824 Gene Summary: Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Page 1/1 Powered by TCPDF (www.tcpdf.org).