CRYBA4 (Human) Recombinant nuclei during development, these crystallins are made Protein (Q01) and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins Catalog Number: H00001413-Q01 are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a Regulation Status: For research use only (RUO) superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist Product Description: Human CRYBA4 partial ORF ( in crystallins: four homologous motifs, a connecting NP_001877, 96 a.a. - 195 a.a.) recombinant protein with peptide, and N- and C-terminal extensions. GST-tag at N-terminal. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the Sequence: basic group, none in the acidic group). Beta-crystallins PAACANHRDSRLTIFEQENFLGKKGELSDDYPSLQAM form aggregates of different sizes and are able to GWEGNEVGSFHVHSGAWVCSQFPGYRGFQYVLECD self-associate to form dimers or to form heterodimers HHSGDYKHFREWGSHAPTFQVQSIRRIQ with other beta-crystallins. This gene, a beta acidic group member, is part of a gene cluster with beta-B1, Host: Wheat Germ (in vitro) beta-B2, and beta-B3. [provided by RefSeq] Theoretical MW (kDa): 36.74 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 1413 Gene Symbol: CRYBA4 Gene Alias: - Gene Summary: Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages1 Page
-
File Size-