
HBA1 (HBA2, Hemoglobin Subunit alpha, Alpha-globin, Hemoglobin alpha Chain, MGC126895, MGC126897) Catalog number 127733 Supplier United States Biological HBA2 located on chromosome 16 spans about 30kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported. Applications Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution Optimal dilutions to be determined by the researcher. AA Sequence MFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLV TLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR Storage and Stability May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Immunogen Partial recombinant corresponding to aa33-142 from human HBA1 (NP_000549) with GST tag. MW of the GST tag alone is 26kD. Formulation Supplied as a liquid in PBS, pH 7.2. Purity Purified by Protein A affinity chromatography. Specificity Recognizes human HBA1. Product Type Mab Source human Isotype IgG2a,k Grade Affinity Purified Applications E WB Crossreactivity Hu Storage -20°C Reference 1. The differentiating and apoptotic effects of 2-aza-5'-deoxycytidine are dependent on the PU.1 expression level in PU.1-transgenic K562 cells. Aoyama S, Nakano H, Danbara M, Higashihara M, Harigae H, Takahashi S.Biochem Biophys Res Commun. 2012 Mar 20. [Epub ahead of print] Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-