DNAI1 (Human) Recombinant Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Protein (P01) Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid Catalog Number: H00027019-P01 repeated freezing and thawing. Regulation Status: For research use only (RUO) Entrez GeneID: 27019 Product Description: Human DNAI1 full-length ORF ( Gene Symbol: DNAI1 AAH30583, 1 a.a. - 699 a.a.) recombinant protein with GST-tag at N-terminal. Gene Alias: CILD1, ICS, ICS1, MGC26204, PCD Sequence: Gene Summary: The inner- and outer-arm dyneins, MIPASAKSPHKQPHKQSISIGRGTRKRDEDSGTEVGE which bridge between the doublet microtubules in GTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNP axonemes, are the force-generating proteins responsible HAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPK for the sliding movement in axonemes. The intermediate DSDEGRRQHYRDELVAGSQESVKVISETGNLEEDEEP and light chains, thought to form the base of the dynein KELETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERK arm, help mediate attachment and may also participate LTNQFNFSERASQTCNNPVRDRECQTEPPPRTNFSAT in regulating dynein activity. This gene encodes an ANQWEIYDAYVEELEKQEKTKEKEKAKTPVAKKSGKM intermediate chain dynein, belonging to the large family AMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIA of motor proteins. Mutations in this gene result in QDFKYYDDAADEYRDQVGTLLPLWKFQNDKAKRLSV abnormal ciliary ultrastructure and function associated TALCWNPKYRDLFAVGYGSYDFMKQSRGMLLLYSLK with primary ciliary dyskinesia (PCD) and Kartagener NPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNV syndrome. [provided by RefSeq] AIYNLKKPHSQPSFCSSAKSGKHSDPVWQVKWQKDD MDQNLNFFSVSSDGRIVSWTLVKRKLVHIDVIKLKVEG STTEVPEGLQLHQVGCGTAFDFHKEIDYMFLVGTEEG KIYKCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVF MSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPY SSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKKNRL THVQFNLIHPIIIVGDDRGHIISLKLSPNLRKMPKEKKGQ EVQKGPAVEIAKLDKLLNLVREVKIKT Host: Wheat Germ (in vitro) Theoretical MW (kDa): 102.63 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Page 1/1 Powered by TCPDF (www.tcpdf.org).