GSTA4 purified MaxPab mouse mammalian glutathione S-transferases have been polyclonal antibody (B01P) identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase Catalog Number: H00002941-B01P belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are Regulatory Status: For research use only (RUO) highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of Product Description: Mouse polyclonal antibody raised lipid peroxidation products. Reactive electrophiles against a full-length human GSTA4 protein. produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's Immunogen: GSTA4 (AAH15523, 1 a.a. ~ 222 a.a) disease, Alzheimer's disease, cataract formation, and full-length human protein. atherosclerosis. [provided by RefSeq] Sequence: References: MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLE 1. Glutathione S-transferase alpha 4 induction by TKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHY activator protein 1 in colorectal cancer. Yang Y, Huycke IADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLK MM, Herman TS, Wang X. Oncogene. 2016 Apr 11. PDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGN [Epub ahead of print] QLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIP TIKRFLEPGSKKKPPPDEIYVRTVYNIFRP Host: Mouse Reactivity: Human Applications: WB-Ce, WB-Tr (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Storage Buffer: In 1x PBS, pH 7.4 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 2941 Gene Symbol: GSTA4 Gene Alias: DKFZp686D21185, GSTA4-4, GTA4 Gene Summary: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic Page 1/1 Powered by TCPDF (www.tcpdf.org).