Product datasheet Anti-LGALS3BP Antibody Catalog Number: A02938-1 BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected] Basic Information Product Name Anti-LGALS3BP Antibody Gene Name LGALS3BP Source Rabbit IgG Species Reactivity human,mouse Tested Application WB,IHC-P Contents 500ug/ml antibody with PBS ,0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen A synthetic peptide corresponding to a sequence of human LGALS3BP (HEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPR). Purification Immunogen affinity purified. Observed MW 65KD Dilution Ratios Western blot: 1:500-2000 Immunohistochemistry in paraffin section: 1:50-400 (Boiling the paraffin sections in 10mM citrate buffer,pH6.0,or PH8.0 EDTA repair liquid for 20 mins is required for the staining of formalin/paraffin sections.) Optimal working dilutions must be determined by end user. Storage 12 months from date of receipt,-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing Background Information Galectin-3-binding protein is a protein that in humans is encoded by the LGALS3BP gene. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1. Reference Anti-LGALS3BP Antibody被引用在0文献中。 暂无引用 FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 1 Product datasheet Anti-LGALS3BP Antibody Catalog Number: A02938-1 BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected] Selected Validation Data Figure 1. Western blot Figure 2. IHC analysis of analysis of LGALS3BP LGALS3BP using anti- using anti-LGALS3BP LGALS3BP antibody antibody (A02938-1). (A02938-1).LGALS3BP Lane 1: human Hela was detected in paraffin- whole cell lysates,Lane 2: embedded section of human COLO-320 whole human mammary cancer cell lysates,Lane 3: mouse tissue. rabbit anti- HEPA1-6 whole cell LGALS3BP Antibody lysates. anti-LGALS3BP (A02938-1) . Biotinylated antigen affinity purified goat anti-rabbit IgG was polyclonal antibody used as secondary (Catalog # antibody . The tissue A02938-1)probed with a section was developed goat anti-rabbit IgG-HRP using Strepavidin-Biotin- secondary antibody The Complex (SABC)(Catalog signal is developed using # SA1022) with DAB as an Enhanced the chromogen. Chemiluminescent detection (ECL) kit (Catalog # EK1002) . A specific band was detected for LGALS3BP at approximately 75KD. The expected band size for LGALS3BP is at 65KD. Figure 3. IHC analysis of Figure 4. IHC analysis of LGALS3BP using anti- LGALS3BP using anti- LGALS3BP antibody LGALS3BP antibody (A02938-1).LGALS3BP (A02938-1).LGALS3BP was detected in paraffin- was detected in paraffin- embedded section of embedded section of human intestinal cancer human lung cancer tissue. rabbit anti- tissue. rabbit anti- LGALS3BP Antibody LGALS3BP Antibody (A02938-1) . Biotinylated (A02938-1) . Biotinylated goat anti-rabbit IgG was goat anti-rabbit IgG was used as secondary used as secondary antibody . The tissue antibody . The tissue section was developed section was developed using Strepavidin-Biotin- using Strepavidin-Biotin- Complex (SABC)(Catalog Complex (SABC)(Catalog # SA1022) with DAB as # SA1022) with DAB as the chromogen. the chromogen. FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 2 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-