WNT3 (Human) Recombinant Gene Alias: INT4, MGC131950, MGC138321, Protein (P01) MGC138323 Gene Summary: The WNT gene family consists of Catalog Number: H00007473-P01 structurally related genes which encode secreted Regulation Status: For research use only (RUO) signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, Product Description: Human WNT3 full-length ORF ( including regulation of cell fate and patterning during NP_110380.1, 1 a.a. - 355 a.a.) recombinant protein with embryogenesis. This gene is a member of the WNT GST-tag at N-terminal. gene family. It encodes a protein which shows 98% amino acid identity to mouse Wnt3 protein, and 84% to Sequence: human WNT3A protein, another WNT gene product. The MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTS mouse studies show the requirement of Wnt3 in primary LGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVAEGVKL axis formation in the mouse. Studies of the gene GIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRES expression suggest that this gene may play a key role in AFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPP some cases of human breast, rectal, lung, and gastric GEGWKWGGCSEDADFGVLVSREFADARENRPDARS cancer through activation of the WNT-beta-catenin-TCF AMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTC signaling pathway. This gene is clustered with WNT15, WWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWV another family member, in the chromosome 17q21 ETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSF region. [provided by RefSeq] GTRDRTCNVTSHGIDGCDLLCCGRGHNTRTEKRKEK CHCIFHWCCYVSCQECIRIYDVHTCK References: 1. Thalamic WNT3 Secretion Spatiotemporally Host: Wheat Germ (in vitro) Regulates the Neocortical Ribosome Signature and mRNA Translation to Specify Neocortical Cell Subtypes. Theoretical MW (kDa): 66 Kraushar ML, Viljetic B, Wijeratne HR, Thompson K, Jiao X, Pike JW, Medvedeva V, Groszer M, Kiledjian M, Applications: AP, Array, ELISA, WB-Re Hart RP, Rasin MR. J Neurosci. 2015 Aug (See our web site product page for detailed applications 5;35(31):10911-26. information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 7473 Gene Symbol: WNT3 Page 1/1 Powered by TCPDF (www.tcpdf.org).