![Arp40431 P050](https://data.docslib.org/img/3a60ab92a6e30910dab9bd827208bcff-1.webp)
Aviva Systems Biology RDBP antibody - N-terminal region (ARP40431_P050) Product Number ARP40431_P050 Product Page http://www.avivasysbio.com/rdbp-antibody-n-terminal-region-arp40431-p050.html Product Name RDBP antibody - N-terminal region (ARP40431_P050) Size 100 ul Gene Symbol NELFE Alias Symbols D6S45, NELF-E, RD, RDP, RDBP Protein Size (# AA) 380 amino acids Molecular Weight 43kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 7936 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full RD RNA binding protein Name Description This is a rabbit polyclonal antibody against RDBP. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: LVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLS Target Reference Rao,J.N., (2008) Biochemistry 47 (12), 3756-3761 Description of RDBP is part of a complex termed negative elongation factor (NELF) which represses Target RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA- binding proteins; however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D).The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. Protein Interactions CCDC57; MTUS2; TRIM27; UBC; SRPK2; SRPK1; LMNA; POLR2C; SUMO1; NELFCD; NELFB; SF3B1; NELFA; TMEM141; RPAP2; WDR48; VAMP3; NCOR1; NELFE; POLR2A; CACTIN; Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Lead Time Domestic: within 6-8 weeks delivery International: 6-8 weeks *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges Blocking Peptide For anti-NELFE (ARP40431_P050) antibody is Catalog # AAP40431 (Previous Catalog # AAPS03008) Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RDBP Complete Anti-RDBP (ARP40431_P050) computational species homology data Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RDBP. Swissprot Id P18615 Protein Name Negative elongation factor E Publications Schulz, M. et al. Quantitative phosphoproteomic analysis of early alterations in protein phosphorylation by 2,3,7,8-tetrachlorodibenzo-p-dioxin. J. Proteome Res. 12, 866-82 (2013). WB, Human, Pig, Horse, Rabbit, Mouse, Rat, Guinea pig, Bovine, Yeast 23298284 Protein Accession NP_002895 # Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RDBP. Nucleotide NM_002904 Accession # Conjugation ARP40431_P050-FITC Conjugated Options ARP40431_P050-HRP Conjugated ARP40431_P050-Biotin Conjugated Species Reactivity Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast Application WB Predicted Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: Homology Based 100%; Rat: 100%; Yeast: 83% on Immunogen Sequence Image 1: Human Brain WB Suggested Anti-RDBP Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human brain AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users. 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2.
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-