Rsph9 (NM 029338) Mouse Tagged ORF Clone Product Data

Rsph9 (NM 029338) Mouse Tagged ORF Clone Product Data

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MG203720 Rsph9 (NM_029338) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Rsph9 (NM_029338) Mouse Tagged ORF Clone Tag: TurboGFP Symbol: Rsph9 Synonyms: 1700027N10Rik Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MG203720 representing NM_029338 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACGCCGACAGCCTCTTGTTGTCTCTGGAGTTGGCGTCTGGCAGTGGGCAGGGACTCAGCCCTGACC GTCGGGCCTCACTGCTCACGTCCCTTATGCTGGTGAAGCGCGATTACCGCTTCGCGAGGGTCCTTTTCTG GGGCCGCATCCTTGGCCTTGTGGCGGATTACTACATCGCACAGGGCTTGAGTGAGGACCAGCTCGCACCA CGCAAGACGCTCTACAGCCTGAACTGCACAGAGTGGAGTCTCTTGCCCCCTGCCACAGAGGAGATGGCCA TGCAGATATCTGTGGTGAGTGGCCGTTTCATGGGCGACCCTTCACACGAGTATGAACACACAGAGTTGCA GAAGGTTAACGAAGGAGAGAAGGTCTTTGATGAAGAAGTGGTGGTCCAGATCAAGGAAGAGACTCGCTTG GTGTCCATCATTGACCAGATTGACAAGGCTGTAGCTATCATCCCTCGAGGTGCCCTCTTCAAGACCCCTT TTGGAGTCACCCATGTCAATCGGACCTTTGAAGGCCTGCCCCTGTCCGAGGTCAGGAAGCTTAGCTCGTA CTTCCACTTCAGGGAGGCTATTGATCTGAAGAACAAGACCTTGCTGGAGAAGTCGGACTTGGAGCCCTCG CTGGATTTCCTGGACTCCCTGGAATATGACATCCCCAGAGGGTCTTGGAGCATCCAGATGGAAAGGGGCA ACGCACTGGTGGTGCTGCGCAGCCTGCTCTGGCCAGGCCTCACCTTCTACCACGCTCCTCGCACCAAGAA CTATGGCTACATCTACGTAGGCACAGGAGAGAAGAACATGGACTTGCCCTTCATGCTG ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Rsph9 (NM_029338) Mouse Tagged ORF Clone – MG203720 Protein Sequence: >MG203720 representing NM_029338 Red=Cloning site Green=Tags(s) MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRFARVLFWGRILGLVADYYIAQGLSEDQLAP RKTLYSLNCTEWSLLPPATEEMAMQISVVSGRFMGDPSHEYEHTELQKVNEGEKVFDEEVVVQIKEETRL VSIIDQIDKAVAIIPRGALFKTPFGVTHVNRTFEGLPLSEVRKLSSYFHFREAIDLKNKTLLEKSDLEPS LDFLDSLEYDIPRGSWSIQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYIYVGTGEKNMDLPFML TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_029338 ORF Size: 828 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Rsph9 (NM_029338) Mouse Tagged ORF Clone – MG203720 OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_029338.4 RefSeq Size: 945 bp RefSeq ORF: 831 bp Locus ID: 75564 UniProt ID: Q9D9V4 Gene Summary: Probable component of the axonemal radial spoke head (By similarity). Radial spokes are regularly spaced along cilia, sperm and flagella axonemes. They consist of a thin stalk, which is attached to a subfiber of the outer doublet microtubule, and a bulbous head, which is attached to the stalk and appears to interact with the projections from the central pair of microtubules.[UniProtKB/Swiss-Prot Function] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us