Anti-SPA17 monoclonal antibody, clone 4C7 (CABT-22184MH) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22. Mouse monoclonal antibody raised against a partial recombinant SPA17. Immunogen SPA17 (NP_059121, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG2a Source/Host Mouse Species Reactivity Human Clone 4C7 Conjugate Unconjugated Applications WB,sELISA,ELISA Sequence Similarities EKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKE EVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEE* Size 100 μg Buffer In 1x PBS, pH 7.2 Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved GENE INFORMATION Gene Name SPA17 sperm autoantigenic protein 17 [Homo sapiens] Official Symbol SPA17 Synonyms sperm autoantigenic protein 17; Sperm protein 17; CT22; SP17-1; SP17; sperm surface protein Sp17; Cancer/testis antigen 22; OTTHUMP00000231527; OTTHUMP00000231528 Entrez Gene ID 53340 Protein Refseq NP_059121 UniProt ID Q15506 Chromosome Location 11q24.2 Function cAMP-dependent protein kinase regulator activity 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.