Product Datasheet: ARP40177 P050

Product Datasheet: ARP40177 P050

Aviva Systems Biology TUBB2A antibody - middle region (ARP40177_P050) Product Number ARP40177_P050 Product Page http://www.avivasysbio.com/tubb2a-antibody-middle-region-arp40177-p050.html Product Name TUBB2A antibody - middle region (ARP40177_P050) Size 100 ul Gene Symbol TUBB2A Alias Symbols TUBB, TUBB2, dJ40E16.7 Protein Size (# AA) 445 amino acids Molecular Weight 49kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 7280 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Tubulin, beta 2A class IIa Name Description This is a rabbit polyclonal antibody against TUBB2A. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC Target Reference Frum,R., (2007) J. Proteome Res. 6 (4), 1410-1417 Description of TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It Target binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain. Protein Interactions HUWE1; UBC; TPT1; TP53; EMD; SUMO2; CDC20; CEP76; FAM96B; TUBGCP4; TUBGCP2; NEDD8; ASB4; RNF2; rev; TUBA1C; NSFL1C; UBXN1; TWF2; TUBB4B; PLAA; PAPSS2; YWHAE; TUFM; TUBA4A; QARS; PFKM; PCBP1; HK1; CAPN2; TUBB8; TUBB; LATS2; UPF2; EGFR; ADRB2; SOX2; CD81; P Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 1-2 days delivery International: 1-2 days *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges Blocking Peptide For anti-TUBB2A (ARP40177_P050) antibody is Catalog # AAP40177 (Previous Catalog # AAPP22023) Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TUBB2A 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Complete Anti-TUBB2A (ARP40177_P050) computational species homology data Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TUBB2A. Swissprot Id Q13885 Protein Name Tubulin beta-2A chain Sample Type TUBB2A is supported by BioGPS gene expression data to be expressed in HepG2 Confirmation Protein Accession NP_001060 # Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TUBB2A. Nucleotide NM_001069 Accession # Replacement Item This antibody may replace item sc-108881 from Santa Cruz Biotechnology. Conjugation ARP40177_P050-FITC Conjugated Options ARP40177_P050-HRP Conjugated ARP40177_P050-Biotin Conjugated CB Replacement sc-108881; sc-134229; sc-47751; sc-5274; sc-53140; sc-55529; sc-58882; sc-58884; sc-58886; sc-80011; sc-9104; sc-9935 Species Reactivity Human, Mouse, Rat, Sheep Application IHC, WB Predicted Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100% Homology Based on Immunogen Sequence Image 1: Small intestine, myenteric plexus Small intestine, myenteric plexus Image 2: Human HepG2 Host: Rabbit Target Name: TUBB2A Antibody Dilution: 1.0ug/ml Sample Type: HepG2 cell lysate TUBB2A is supported by BioGPS gene expression data to be expressed in HepG2 AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users. 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    2 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us