Anti-DBF4B (aa 1-50) polyclonal antibody (DPABH- 12596) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description Regulatory subunit for CDC7 which activates its kinase activity thereby playing a central role in DNA replication and cell proliferation. Required for progression of S and M phases. The complex CDC7-DBF4B selectively phosphorylates MCM2 subunit at Ser-40 and then is involved in regulating the initiation of DNA replication during cell cycle. Immunogen Synthetic peptide within Human DBF4B aa 1-50 (N terminal). The exact sequence is proprietary. (NP_079380.2)Sequence: MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSG Database link: Q8NFT6-2 Run BLAST with Run BLAST with Isotype IgG Source/Host Rabbit Species Reactivity Human Purification Immunogen affinity purified Conjugate Unconjugated Applications WB Format Liquid Size 50 μg Preservative None Storage Shipped at 4°C. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. GENE INFORMATION Gene Name DBF4B DBF4 homolog B (S. cerevisiae) [ Homo sapiens ] Official Symbol DBF4B 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Synonyms DBF4B; DBF4 homolog B (S. cerevisiae); protein DBF4 homolog B; ASKL1; chifb; chiffon homolog B (Drosophila); DRF1; FLJ13087; ZDBF1B; zinc finger; DBF type containing 1B; chiffon homolog B; ASK-like protein 1; Dbf4-related factor 1; zinc finger, DBF-type containing 1B; activator of S-phase kinase-like protein 1; CHIFB; MGC15009; Entrez Gene ID 80174 Protein Refseq NP_079380 UniProt ID Q8NFT6 Chromosome Location 17q21.31 Function metal ion binding; nucleic acid binding; zinc ion binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.