
Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic PCDHB2 (Human) Recombinant Purification: Glutathione Sepharose 4 Fast Flow Protein (P01) Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Catalog Number: H00056133-P01 Storage Instruction: Store at -80°C. Aliquot to avoid Regulation Status: For research use only (RUO) repeated freezing and thawing. Product Description: Human PCDHB2 full-length ORF Entrez GeneID: 56133 ( AAH98575.1, 1 a.a. - 798 a.a.) recombinant protein with GST-tag at N-terminal. Gene Symbol: PCDHB2 Sequence: Gene Alias: MGC111392, PCDH-BETA2 MEAGEGKERVPKQRQVLIFFVLLGIAQASCQPRHYSV AEETESGSFVANLLKDLGLEIGELAVRGARVVSKGKK Gene Summary: This gene is a member of the MHLQFDRQTGDLLLNEKLDREELCGPTEPCVLPFQVL protocadherin beta gene cluster, one of three related LENPLQFFQAELRIRDVNDHSPVFLDKEILLKIPESITPG gene clusters tandemly linked on chromosome five. The TTFLIERAQDLDVGTNSLQNYTISPNFHFHLNLQDSLD gene clusters demonstrate an unusual genomic GIILPQLVLNRALDREEQPEIRLTLTALDGGSPPRSGTA organization similar to that of B-cell and T-cell receptor LVRIEVVDINDNVPEFAKLLYEVQIPEDSPVGSQVAIVS gene clusters. The beta cluster contains 16 genes and 3 ARDLDIGTNGEISYAFSQASEDIRKTFRLSAKSGELLLR pseudogenes, each encoding 6 extracellular cadherin QKLDFESIQTYTVNIQATDGGGLSGTCVVFVQVMDLN domains and a cytoplasmic tail that deviates from others DNPPELTMSTLINQIPENLQDTLIAVFSVSDPDSGDNG in the cadherin superfamily. The extracellular domains RMVCSIQDDLPFFLKPSVENFYTLVISTALDRETRSEY interact in a homophilic manner to specify differential NITITVTDFGTPRLKTEHNITVLVSDVNDNAPAFTQTSY cell-cell connections. Unlike the alpha and gamma TLFVRENNSPALHIGSVSATDRDSGTNAQVTYSLLPPQ clusters, the transcripts from these genes are made up DPHLPLASLVSINADNGHLFALQSLDYEALQAFEFRVG of only one large exon, not sharing common 3' exons as AADRGSPALSSEALVRVLVLDANDNSPFVLYPLQNGS expected. These neural cadherin-like cell adhesion APCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQ proteins are integral plasma membrane proteins. Their LLKATEPGLFGVWAHNGEVRTARLLRERDAAKQRLVV specific functions are unknown but they most likely play LVKDNGEPPRSATATLHVLLVDGFSQPYLLLPEAAPAQ a critical role in the establishment and function of AQADLLTVYLVVALASVSSLFLFSVLLFVAVRLCRRSR specific cell-cell neural connections. [provided by AASVGRCSVPEGPFPGQMVDVSGTGTLSQSYQYEVC RefSeq] LTGESGTNEFKFLKPIIPNFVAQGAERVSEANPSFRKS FEFT Host: Wheat Germ (in vitro) Theoretical MW (kDa): 113.7 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-