FXYD2 Monoclonal Antibody (M01), Human Gene Nomenclature for the Family Is Clone 1C3-B3 FXYD-Domain Containing Ion Transport Regulator

FXYD2 Monoclonal Antibody (M01), Human Gene Nomenclature for the Family Is Clone 1C3-B3 FXYD-Domain Containing Ion Transport Regulator

FXYD2 monoclonal antibody (M01), human gene nomenclature for the family is clone 1C3-B3 FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). Catalog Number: H00000486-M01 FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. Regulatory Status: For research use only (RUO) FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been Product Description: Mouse monoclonal antibody shown to induce channel activity in experimental raised against a full length recombinant FXYD2. expression systems. Transmembrane topology has been established for two family members (FXYD1 and Clone Name: 1C3-B3 FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Immunogen: FXYD2 (AAH05302.1, 1 a.a. ~ 64 a.a) The Type III integral membrane protein encoded by this full-length recombinant protein with GST tag. MW of the gene is the gamma subunit of the Na,K-ATPase present GST tag alone is 26 KDa. on the plasma membrane. Although the Na,K-ATPase does not depend on the gamma subunit to be functional, Sequence: it is thought that the gamma subunit modulates the MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFI enzyme's activity by inducing ion channel activity. VGLLILLSRRFRCGGNKKRRQINEDEP Mutations in this gene have been associated with renal Host: Mouse hypomagnesaemia. Alternatively spliced transcript variants encoding different isoforms have been found for Reactivity: Human this gene. [provided by RefSeq] Applications: ELISA, IHC-P, S-ELISA, WB-Ce, WB-Re References: (See our web site product page for detailed applications 1. A genomic-based approach identifies FXYD domain information) containing ion transport regulator 2 (FXYD2)gammaa as a pancreatic beta cell-specific biomarker. Flamez D, Protocols: See our web site at Roland I, Berton A, Kutlu B, Dufrane D, Beckers MC, De http://www.abnova.com/support/protocols.asp or product Waele E, Rooman I, Bouwens L, Clark A, Lonneux M, page for detailed protocols Jamar JF, Goldman S, Marechal D, Goodman N, Gianello P, Van Huffel C, Salmon I, Eizirik DL. Isotype: IgG2b kappa Diabetologia. 2010 Apr 9. [Epub ahead of print] Storage Buffer: In 1x PBS, pH 7.4 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 486 Gene Symbol: FXYD2 Gene Alias: ATP1G1, HOMG2, MGC12372 Gene Summary: This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved Page 1/1 Powered by TCPDF (www.tcpdf.org).

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    1 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us