Mouse Tagged ORF Clone – MG201280

Mouse Tagged ORF Clone – MG201280

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MG201280 Selenof (NM_053102) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Selenof (NM_053102) Mouse Tagged ORF Clone Symbol: Selenof Synonyms: 9430015P09Rik; Sep; Sep15 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MG201280 representing NM_053102 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGGCAGGGCAGGGTGGGTGGCTGCGGCCCGCTCTGGGGCTGCGCTTGCTGCTGGCGACTGCGTTTC AAGCGGCGTCTGCTCTGGGGGCAGAGTTTGCGTCAGAGGCATGCAGAGAGTTGGGTTTCTCCAGCAACTT GCTCTGCAGCTCTTGCGATCTTCTTGGACAGTTTAATCTGCTCCCACTGGATCCTGTTTGCAGAGGGTGC TGTCAGGAAGAAGCACAATTTGAAACCAAAAAGCTGTATGCAGGAGCCATCCTTGAAGTCTGCGGATGAA AATTGGGGAGGTTCCCTCAAGTCCAAGCTTTTGTCAGAAGTGATAAACCCAAACTCTTCAGAGGTCTACA GATCAAGTATGTTCGAGGCTCAGACCCTGTACTAAAGCTTTTGGACGACAACGGGAACATTGCTGAAGAA CTAAGCATCCTCAAGTGGAACACAGACAGTGTGGAAGAGTTCCTGAGCGAGAAGTTGGAACGCATA ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >MG201280 representing NM_053102 Red=Cloning site Green=Tags(s) MAAGQGGWLRPALGLRLLLATAFQAASALGAEFASEACRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGC CQEEAQFETKKLYAGAILEVCG*KLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEE LSILKWNTDSVEEFLSEKLERI TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Selenof (NM_053102) Mouse Tagged ORF Clone – MG201280 Cloning Scheme: Plasmid Map: ACCN: NM_053102 OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins. This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Selenof (NM_053102) Mouse Tagged ORF Clone – MG201280 OTI Annotation: This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins. RefSeq: NM_053102.2, NP_444332.1 RefSeq Size: 1515 bp RefSeq ORF: 489 bp UniProt ID: Q9ERR7 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us