
Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic PRKAG3 (Human) Recombinant Entrez GeneID: 53632 Protein (P01) Gene Symbol: PRKAG3 Catalog Number: H00053632-P01 Gene Alias: AMPKG3 Regulation Status: For research use only (RUO) Gene Summary: The protein encoded by this gene is a Product Description: Human PRKAG3 full-length ORF regulatory subunit of the AMP-activated protein kinase ( NP_059127.2, 1 a.a. - 489 a.a.) recombinant protein (AMPK). AMPK is a heterotrimer consisting of an alpha with GST-tag at N-terminal. catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme Sequence: that monitors cellular energy status. In response to MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSS cellular metabolic stresses, AMPK is activated, and thus WPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGEPP phosphorylates and inactivates acetyl-CoA carboxylase GQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGT (ACC) and beta-hydroxy beta-methylglutaryl-CoA PPTGWDCLPSDCTASAAGSSTDDVELATEFPATEAW reductase (HMGCR), key enzymes involved in regulating ECELEGLLEERPALCLSPQAPFPKLGWDDELRKPGAQ de novo biosynthesis of fatty acid and cholesterol. This IYMRFMQEHTCYDAMATSSKLVIFDTMLEIKKAFFALVA subunit is one of the gamma regulatory subunits of NGVRAAPLWDSKKQSFVGMLTITDFILVLHRYYRSPLV AMPK. It is dominantly expressed in skeletal muscle. QIYEIEQHKIETWREIYLQGCFKPLVSISPNDSLFEAVYT Studies of the pig counterpart suggest that this subunit LIKNRIHRLPVLDPVSGNVLHILTHKRLLKFLHIFGSLLP may play a key role in the regulation of energy RPSFLYRTIQDLGIGTFRDLAVVLETAPILTALDIFVDRR metabolism in skeletal muscle. [provided by RefSeq] VSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMS VGEALRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHR LVLVDETQHLLGVVSLSDILQALVLSPAGIDALGA Host: Wheat Germ (in vitro) Theoretical MW (kDa): 80.7 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-