
PDCD6IP (Human) Recombinant Preparation Method: in vitro wheat germ expression Protein (P01) system Purification: Glutathione Sepharose 4 Fast Flow Catalog Number: H00010015-P01 Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Regulation Status: For research use only (RUO) Glutathione, pH=8.0 in the elution buffer. Product Description: Human PDCD6IP full-length ORF Storage Instruction: Store at -80°C. Aliquot to avoid ( AAH20066, 1 a.a. - 868 a.a.) recombinant protein with repeated freezing and thawing. GST-tag at N-terminal. Entrez GeneID: 10015 Sequence: MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQ Gene Symbol: PDCD6IP YCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQIC SIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALA Gene Alias: AIP1, Alix, DRIP4, HP95, MGC17003 SLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKH YQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIM Gene Summary: This gene encodes a protein thought LAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFK to participate in programmed cell death. Studies using QCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQ mouse cells have shown that overexpression of this QKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKI protein can block apoptosis. In addition, the product of NRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTP this gene binds to the product of the PDCD6 gene, a VNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVN protein required for apoptosis, in a calcium-dependent RSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSIL manner. This gene product also binds to endophilins, TKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLL proteins that regulate membrane shape during DEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNF endocytosis. Overexpression of this gene product and RTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNA endophilins results in cytoplasmic vacuolization, which AIPSANPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLE may be partly responsible for the protection against cell NDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVY death. Several alternatively spliced transcript variants GGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNE encoding different isoforms have been found for this ANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEIL gene. [provided by RefSeq] VRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAPSIP TPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPP PVLPANRAPSATAPSPVGAGTAAPAPSQTPGSAPPPQ AQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMP YPPVYHQSPGQAPYPGPQQPSYPFPQPPQQSYYPQ Q Host: Wheat Germ (in vitro) Theoretical MW (kDa): 121.11 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages1 Page
-
File Size-