BCL2L2 (NM 004050) Human Tagged ORF Clone – RC211152 | Origene

BCL2L2 (NM 004050) Human Tagged ORF Clone – RC211152 | Origene

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC211152 BCL2L2 (NM_004050) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: BCL2L2 (NM_004050) Human Tagged ORF Clone Tag: Myc-DDK Symbol: BCL2L2 Synonyms: BCL-W; BCL2-L-2; BCLW; PPP1R51 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC211152 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGACCCCAGCCTCGGCCCCAGACACACGGGCTCTGGTGGCAGACTTTGTAGGTTATAAGCTGAGGC AGAAGGGTTATGTCTGTGGAGCTGGCCCCGGGGAGGGCCCAGCAGCTGACCCGCTGCACCAAGCCATGCG GGCAGCTGGAGATGAGTTCGAGACCCGCTTCCGGCGCACCTTCTCTGATCTGGCGGCTCAGCTGCATGTG ACCCCAGGCTCAGCCCAACAACGCTTCACCCAGGTCTCCGATGAACTTTTTCAAGGGGGCCCCAACTGGG GCCGCCTTGTAGCCTTCTTTGTCTTTGGGGCTGCACTGTGTGCTGAGAGTGTCAACAAGGAGATGGAACC ACTGGTGGGACAAGTGCAGGAGTGGATGGTGGCCTACCTGGAGACGCGGCTGGCTGACTGGATCCACAGC AGTGGGGGCTGGGCGGAGTTCACAGCTCTATACGGGGACGGGGCCCTGGAGGAGGCGCGGCGTCTGCGGG AGGGGAACTGGGCATCAGTGAGGACAGTGCTGACGGGGGCCGTGGCACTGGGGGCCCTGGTAACTGTAGG GGCCTTTTTTGCTAGCAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC211152 protein sequence Red=Cloning site Green=Tags(s) MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHV TPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHS SGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6009_d03.zip This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 4 BCL2L2 (NM_004050) Human Tagged ORF Clone – RC211152 Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_004050 ORF Size: 579 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_004050.4 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 4 BCL2L2 (NM_004050) Human Tagged ORF Clone – RC211152 RefSeq Size: 3621 bp RefSeq ORF: 582 bp Locus ID: 599 UniProt ID: Q92843 Domains: Bcl-2, BH4 Protein Families: Druggable Genome, Transmembrane MW: 20.8 kDa Gene Summary: This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF- dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream PABPN1 (poly(A) binding protein, nuclear 1) gene. [provided by RefSeq, Dec 2010] Product images: Western blot validation of overexpression lysate (Cat# [LY401312]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC211152 using transfection reagent MegaTran 2.0 (Cat# [TT210002]). This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 4 BCL2L2 (NM_004050) Human Tagged ORF Clone – RC211152 Coomassie blue staining of purified BCL2L2 protein (Cat# [TP311152]). The protein was produced from HEK293T cells transfected with BCL2L2 cDNA clone (Cat# RC211152) using MegaTran 2.0 (Cat# [TT210002]). This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 4 / 4.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    4 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us