Final Project: Written Report

Final Project: Written Report

Meron Ligaba BNFO 301 Final Project: Written Report May 8, 20009

Metagenome Project

My Story:

As I usually do every Saturday morning, I went to one of my favorite web forums, and clicked on the link to “picture of the day.” What a beautiful picture! I said to myself. I really loved this picture. I didn’t know why, but I just printed out the picture and put it on my desk. I commented on the picture and looked at other things in the forum and somehow it was time for me to go, so I left. After a Figure 1. Yellowstone National Park long day, I went back to my place. The first thing I saw in my room was the picture on my desk. Gorgeous picture! Then, something I read about the picture struck me. “Yellowstone National Park”! I went to Google. I learned that Yellowstone National Park provides vast habitats for a wide variety of thermo tolerant and thermophilic organisms and that microorganisms living in hot springs were first discovered in Yellowstone. That sounds interesting. I was surprised to learn that life can exist in this high temperature. Part of the sources of the beauty for the hot spring is these microbes. How these viruses and bacteria can survive in this temperature is still fascinating to me. After it had been a couple of months after this happened, it was my birth day. I got a ticket to Wyoming. It is usually hard for people to surprise me on my birthday; but this one was a real surprise. I must have annoyed my boy friend talking about the lives in Yellowstone and how beautiful it was. I remember telling him how bad I would love to see the park one day. Anyways, I was happy! Now what? Of course fly to Wyoming! I never had this kind of trip alone, unless it was to visit my family. I was excited but I didn’t know what to expect. But I really hated the fact that I am going to be all alone. I should make friends, don’t I? To my surprise the guy sitting next to me looks weird. I complained: why do I have to sit

1 with people who are not my age whenever I fly? Anyways, I said hi to the guy sitting next to me. He said hi back waving and a big smile. There is something weird about this guy. He looks crazy and so careless about himself. Who cares! Then I asked him where his destination is. He is going to Yellowstone Park for a research. Wow- he must be a researcher! So you are a professor? No, I am not, he answered. He didn’t say further. So what is the research about? Anything I can find, I don’t know! We were quiet for a moment. I asked him if he has ever been here before and all the stuff. I found out he teaches Bioinformatics in the middle of our conversation. I said I have heard about it; don’t tell me you teach at VCU. He said why? He does not know how to answer a question directly. I don’t think the words “Yes” and “No” are in his brain at all. Because I go to VCU, I said. He replied oh, what a coincidence! I took that as a yes. I was glad to find out that. I asked him a lot of questions about bioinformatics. He asked me if I would be interested to do independent research with him. I am Meron, I said. Then he handed me his card in case I had any question. I told him I would keep in touch. The plane landed and we went our separate ways. This guy stuck the word Bioinformatics in my head. And it is after I met this guy, I started considering Bioinformatics as my major. I still don’t know the exact definition of Bioinformatics but I am exploring it. Now that I have decided, I am taking the course Introduction to Bioinformatics. At the end of the semester, we did the following Metagenome project.

Introduction: Metagenome Projects deal with raw sequence reads collected directly from an ecological or organismal source. My read was collected from Octopus Hot springs Metagenome. The goal of the project is to find proteins and genes in the reads and compare it with other sequence reads that have been studied and are found in gene databases. This will help us to predict from which possible organism the read came from, or at least to which organisms it is related to. It is also important to examine what is interesting or strange about this reads. No one has looked at individual reads until now except Tom Schoenfeld, who is a research scientist and vice president at Lucigen Corp., and his colleagues have analyzed the sequences in the aggregate.1 When we first claimed our reads they were unedited raw reads that had unwanted parts due to the way they were sequenced. There was a massive overlapping region when we tried to find overlaps between reads. These massive overlap and unwanted parts came from a plasmid vector,

2 which is used to transfer foreign genetic information to another cell. The vector itself is a small piece of DNA into which a foreign DNA fragment can be inserted 2 .The other unwanted part came from ligated linkers, which are attached in order to provide a unique restriction site that will allow subsequent ligation of the target DNA to a vector DNA molecule.3 Since editing the reads without the aid of a special computer program was a long and time consuming job, the reads were edited to us and we were then able to continue working with them.

Tools and Methods: BioBike: provides a tool to manipulate and analyze genomic, metabolic, and experimental data. It provides a programming language for molecular biologists and students without programming experience. BLAST: Basic Local Alignment Search Tool is a program that finds regions of local similarity between sequences. The program compares nucleotide or protein sequences to sequence databases and calculates the statistical significance of matches. BLAST can be used to infer functional and evolutionary relationships between sequences as well as help identify members of gene families. GeneMark: is a family of gene prediction programs developed at Georgia Institute of Technology. It was the first gene finding method recognized as an efficient and accurate tool for genome projects. We acquired edited reads from BioBike. Even though I had two read I was working with only one of them. This read was OctHSe.APNO1152-b2 and 889 nucleotides long the probability of finding genes in this 889 nucleotides long sequence was very unlikely, I had to extend my read. To extend my read, I used the SEQUENCE SIMILAR TO function to find sequences that are similar to my read in the Octopus Metagenome. That gave me a list of reads. To extend my read, I had to look for overlaps and join the two reads. See appendix A for the coordinates, the reads that were overlapped, and the identity percentage. BioBike has a JOINing function that is handy to do this job. I repeated the process six times and I found a longer sequence that is 2920 nucleotides long (Appendix B). Fig. 2 illustrates the functions I used on BioBike. After that I looked for open reading frames. An Open Reading Frame (ORF) tells us the region of nucleotide sequences from the start codon (ATG) to the stop codon. Once a gene has been sequenced it is important to determine the correct ORF. Every region of DNA has six possible reading frames, three in each

3 direction. The reading frame that is used determines which amino acids will be encoded by a gene.

Figure 2. Extending a read on Biobike

4 BioBike has a function called ORFS-IN that shows the open reading frames. I found many ORFs. The results are illustrated in Fig 3 below.

Figure 3. Open Reading Frames To determine which amino acids will be encoded by a gene, I went to GeneMark. GeneMark found three gene regions, out of which two (2 and 3) matched the ORFs I found above.

Gene Left End Right End Gene Length

1 507 818 312

2 997 1308 312

3 1464 1775 312

Table 1. GeneMark predicted genes This might tell me something about my read. So I went back to Biobike and blasted only these regions against known viruses and Genebank. However, no significant similarities were found. After that, I blasted the entire sequence using nucleotide blast. Again, no significant similarities were found. I tried protein blast after translating the nucleotides (Appendix C) and

5 found two significant alignments. One is a domain protein that is found in Aspergillus Clavatus and the other one is a hypothetical protein that is found in Vanderwaltozyma Polyspora. Both Aspergillus Clavatus and Vanderwaltozyma Polyspora are fungi. 102 of the 371 proteins matched in the first case (Aspergillus Clavatus NRRL 1) and the e-value was 0.17. In the second protein (Vanderwaltozyma Polyspora DSM 70294), 77 out of 553 proteins matched and the e-value was 4.9. The e-value tells us the extent of the matches that are expected to occur in a database search by chance. The lower the E value, the more significant the score.

Discussion of Results:

To discuss the results I found, I went to see my instructor. The first thing I asked him was if the reads had anything to do with the research he was doing when we met in Wyoming. As I said above, there is no “yes” or “no”. He replied, I don’t know. Anyways, I said ok and explained what I found. I asked him if that was right. He said, I don’t know- you tell me! I supposed, I can’t say if the result was right or wrong. It might be possible that the read was derived from one of the fungi or it might be related to the families of these organisms. He said it might be possible. He suggested that I should probably extend the read more and try to find out more proteins and genes and he would tell me if the read I was working with had been isolated by the research he did when we met in Wyoming.

Appendix A

Overlapping sequences

6 1 407 889

OctHSe.APNO1152-b2

1 477 1032 OctHSe.ATYB3955-b2 1 1373 M1

Query T-Start T-end Target T-Start T-End E-value % OctHSe.APNO1152-b2 407 889 OctHSe.ATYB3955-b2 1 - 477 0.0 96.89

1 906 1373 M1

1 467 991 OctHSe.ATYB1387-g2

1 M2

Query T-Start T-end Target T-Start T-End E-value % Seq1(m1) 907 1373 OctHSe.ATYB1387-g2 1 467 0.0 99.14

7 1 477 1840

M2

1 527 996 OctHSe.ATYB6110-b2

1 2310 M3

Query T-Start T-end Target T-Start T-End E-value % Seq1 (m2) 7 477 OctHSe.ATYB6110-b2 527 996 1.0d-87 83.86

1 2007 2310 M3

1 305 935 OctHSe.ATYB4954-g2

1 2615 M4

Query T-Start T-end Target T-Start T-End E-value % Seq1 (m3) 2007 2310 OctHSe.ATYB4954-g2 1 305 4.0d-60 84.92

8 1 2311 2615 M4

884 6 310 OctHSe.APNO3972-g2

1 2920 M5

Query T-Start T-end Target T-Start T-End E-value % Seq1 (m4) 2311 2615 OctHSe.APNO3972-g2 6 310 7.0d-158 98.03

1 2311 2615 M5

884 6 310 OctHSe.APNO2275-b6

1 2920 M6

Query T-Start T-end Target T-Start T-End E-value % Seq1 (m5) 2719 2920 OctHSe.APNO2275-b6 1 202 1.0d-48 87.13

Appendix B Extended Read ATCTTATGTGAGGCAACTCGGCGTGTCGAATATACGGCGTATGGCGTGTCGTGTTACGTGTGACGTGTCGGCGTTACTATTATCGC TTTCTGTGCGCTAGCCCGGCGTATCGAGTATACGGCGTACAGTATACGTCTCGAGAGACGCCATGTCGGCGTCGCTAGTGTCGTCT TATGTGCGGCGGCCTGGCGTTGTTAGTATCGGGAGTGTCGAATATACGGCGTGACATGTATCACGCGTATTTTAGATACGTCGCGT CGGTGTCTCTAATGTCAACGTCTCGAGAGACGCCACATCGGCGCCATTATTATCATCTTATGTGCGTCGCGTCGGGGTCTCTAATA TCGCGCGTATCAAGTGTACAGCATGGCGCGTGTCAAATATGTCACAGGCAGATACGTGCGGATACGTCTCGAGAGACGCCTATGTC GGGCATATTAAGACAGGCACAGAAAAACAGACAGGGGAAAAAGCGTGGATAATGACAGGAAAAAAGACGTGTCTAGTTAATCGTAA CGTTCGTTGTAGTAACGATACGCATCTTCGAATGCGTTGACAAACCGATACGGTTCAAGCTCCCAACCGGTAACGACAAAATCATC GCTGTCGTCCTTCCTGTATAGCTCATTTATCAGCTGCGCTATGTCATTGTACATAATGGCAACCCTGCCGTCCTCCGATACGTATA GCCACTTGTCGGCGCCATTAGTATACGTCATATGCCCGTCGATTAGGACTATCCCATGTCTGAGAATTGCCACAGGCAAAAACTTG GTTTTTTTCCTCGTGGTGTTTTTGGTTTGGTTTTTGGTTGCCATGGTCGGCTTTNAAAACCGGGGTTTAAAAAACTTTTCCGCCCC CCCTGGGCCCTTTACATTTTGTAAAGAGGGAAAGGGTACGTCTCGAGAGACGCCTATGTCGGGCATATTAAGACAGGCACAGAAAA ACAGACAGGGGAAAAAGCGTGGATAATGACAGGAAAAAAGACGTGTCTAGTTAATCGTAACGTTCGTTGTAGTAACGATGCGCATC TTCAAATGCGTTGACAAACCGATACGGTTCAAGCTCCCAACCGGTAACGACAAAATCATCGCTGTCGTCCTTCCTGTATAGCTCAT TTATCAGCTGCGCTATGTCATTGTACATAATGGCAACCCTGCCGTCCTCCGATACGTATAGCCACTTGTCGGCGCCATTAGTATAC GTCATATGCCCGTCGATTAGGACTATCCCATGTCTGAGAATTGCCACAGGCAAAAACTTGGTTTTTTTCTCCGTGGTGTTTTTGGT

9 TTGTTTTTTGGTTGCCATGGTCGGCTTGGAAACCTGGGTTTAAAAACTTTTCGCCCCCCTGGCCCTTTACATTTGTAAAGAGGGAG ACGCCTATGTCGGGCATATTAAGACAGGCACAGAAAAACAGACAGGGGAAAAAGCGTGGATAATGACAGGAAAAAAGACGTGTCTA GTTAATCGTAACGTTCGTTGTAGTAACGATACGCATCTTCGAATGCGTCGACAAACCGATACGGTTCGAGCTCCCAACCGGTAACG ACAAAATCATCGCTGTCGTCCTTCCTGTATAGCTCATTTATCAGCTGCGCTATGTCATTGTACATAATGGCAACCCTGCCGTCCTC CGATACGTATAGCCACTTGTCGGCGCCATTAGTATACGTCATATGCCCGTCGATTAGGACTATCCCATGTCTGAGAATTGCCACAG GCAAAAACTTGGTTTTTTTCTCCGTGGTGTTTTTGGTTTGTTTTTTGGTTGCCATGGTCGGCTTGGAAACCTGGGTTTAAAAACTT TTCGCCCCCCTGGCCCTTTACATTTGTAAAGAGGTGTGAGGCGAGTCGGCGTCTCGAATATACGGCGTACGGCGTGTCGCGTTACG CATGTTACGTCGGCGTCTCTATTGACACCTTCTGCGCGCTAGCATGGCGCACTGAGTATACGGCGTACGGCATACGTCTCGAGAGG CGCCGTGCTGGCGTTGCTAGTGTCGTCTTATGTGCGGCGGCCTGGCGCCACTAGTGTCGGAAGTGTTGAATATACGGCGTGGCATG TACCGCGCGTATTTTAGATACGTCGCGTCGGGCGCACTAGTGGCAGCGTCTCGAGAGTCGGCACATCGGCGCCACTATTATCATAT TCTGTGCGCCGCGTCGGGGCCTCTAATATCGCGCGTGTCAAGTGTACCGCGTGGCGCGTGTCGAATATGGCACAGGCGGACCTGTG CAAATACGTCTCGAGAGACGCCTATGCCAAGTACATTAAGACAGGCCCGGAAAACAGACCGGGAAAAAAACGTGTATGTGCGACGG CCTGGCGTTGTTAGTATCGGGAGTGTCGAATATACGGCGTGACATGTATCACGCGTATTTTAGATACGTCGCGTCGGTGTCTCTAA TGTCAACGTCTCGAGAGACGCCACATCGGCGCCATTATTATCATCTTATGTGCGTCGCGTCGGGGTCTCTAATATCGCGCGTATCA AGTGTACAGCATGGCGCGTGTCGAATATGTCACAGGCAGATACGTGCGGATACGTCTCGAGAGACGCCTATGTCGGGCATATTAAG ACAGGCACAGAAAAACAGACAGGGGAAAAAGCGTGGAATATACGGCGTATGGCGTGTCGTGTTACGTGTGACGTGTCGGCGTTACT ATTATCGCTTTCTGTGCGCTAGCCCGGCGTATCGAGTATACGGCGTACAGTATACGTCTCGAGAGACGCCGTGTCGGCGTCGCTAG TGTCGTCTTATGTGCGGCGGCCTGGCGTTGTTAGTATCGGGAGTGTCGAATATACGGCGTGACATGTATCACGCGTATTTTAGATA CGTCGCGTCGGTGTCTCTAATGTCAACGTCTCGAGAGACGCCACATCGGCGCCATTATTATCATCTTATGTGCGTCGCGTCG

Appendix C Translated Proteins "ILCEATRRVEYTAYGVSCYV*RVGVTIIAFCALARRIEYTAYSIRLERRHVGVASVVLCAAAWRC*YRECRIYGVT CITRILDTSRRCL*CQRLERRHIGAIIIILCASRRGL*YRAYQVYSMARVKYVTGRYVRIRLERRLCRAY*DRHRKT DRGKSVDNDRKKDVSS*S*RSL**RYASSNALTNRYGSSSQPVTTKSSLSSFLYSSFISCAMSLYIMATLPSSDTYS HLSAPLVYVICPSIRTIPCLRIATGKNLVFFLVVFLVWFLVAMVGF- NRGLKNFSAPPGPFTFCKEGKGTSRETPMSGILRQAQKNRQGKKRG**QEKRRV*LIVTFVVVTMRIFKCVDKPIRF KLPTGNDKIIAVVLPV*LIYQLRYVIVHNGNPAVLRYV*PLVGAISIRHMPVD*DYPMSENCHRQKLGFFLRGVFGL FFGCHGRLGNLGLKTFRPPGPLHL*RGRRLCRAY*DRHRKTDRGKSVDNDRKKDVSS*S*RSL**RYASSNASTNRY GSSSQPVTTKSSLSSFLYSSFISCAMSLYIMATLPSSDTYSHLSAPLVYVICPSIRTIPCLRIATGKNLVFFSVVFL VCFLVAMVGLETWV*KLFAPLALYICKEV*GESASRIYGVRRVALRMLRRRLY*HLLRASMAH*VYGVRHTSREAPC WRC*CRLMCGGLAPLVSEVLNIRRGMYRAYFRYVASGALVAASRESAHRRHYYHILCAASGPLISRVSSVPRGACRI WHRRTCANTSRETPMPSTLRQARKTDREKNVYVRRPGVVSIGSVEYTA*HVSRVF*IRRVGVSNVNVSRDATSAPLL SSYVRRVGVSNIARIKCTAWRVSNMSQADTCGYVSRDAYVGHIKTGTEKQTGEKAWNIRRMACRVTCDVSALLLSLS VR*PGVSSIRRTVYVSRDAVSASLVSSYVRRPGVVSIGSVEYTA*HVSRVF*IRRVGVSNVNVSRDATSAPLLSSYV RRVVRLERRRAGIASVVLCAAAWRH*RRKCRIYGVACTARILDTSRRRH*WQRLESRHIGATIIIFCASR"

References 1. Schoenfeld T et al. (2008) Appl. Environ. Microbiol. 74:4164-4174. http://aem.asm.org/cgi/reprint/AEM.02598-07v1

2. cSMARTTM cDNA Cloning KitsLucigen® Corporation (2001-2004), http://www.genycell.com/images/productos/protocolos/41015-1__39.pdf.

10 3. Principles of cell-based DNA Cloning. 1999.http://www.ncbi.nlm.nih.gov/books/bv.fcgi? rid=hmg.box.395

11

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    11 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us