A Feasible Method of Improving the Quantum Yield of Cdte/Cds Quantum Dots by the First

A Feasible Method of Improving the Quantum Yield of Cdte/Cds Quantum Dots by the First

<p> Electronic Supporting Information</p><p>Unique self-assembly properties of a bridge-shaped protein dimer with quantum dots</p><p>Jianhao Wang1, 2, * · Pengju Jiang1, * · Liqian Gao2 · Yongsheng Yu2 · Yao Lu2· Lin Qiu1 · Cheli Wang1 · Jiang Xia</p><p>2</p><p>1 School of Pharmaceutical Engineering and Life Science, Changzhou University, Changzhou, Jiangsu, China,</p><p>213164</p><p>2 Department of Chemistry, The Chinese University of Hong Kong, Shatin, Hong Kong, China.</p><p>* These authors contributed equally to this work.</p><p>Correspondence: [email protected] </p><p>1 EXPERIMENTAL SECTION</p><p>Preparation of oil-soluble CdSe/ZnS core-shell QDs </p><p>Core-shell QDs (CdSe/ZnS) were synthesized using a two-step method according to previous reports (Peng et al. 2001; Qu et al. 2001). Briefly, 7 g TOPO and 3 g HDA were mixed and heated in a 50 mL three-neck flask</p><p> for solvent under vacuum. Then 0.125 g cadmium acetate (Cd(Ac)2) was added in the solutions. After the mixture was heated to 310 °C, the heater was removed. And the stock solution of TOP/Se prepared by dissolving 0.2 g selenium in 5 g of TOP was injected quickly into the reaction solution under vigorous stirring, resulting in nucleation of CdSe nanocrystals. The synthesis of the shell of CdSe QDs is briefly described as the</p><p> following. 6 g TOPO, 2 g HDA and 0.2 g Zn(Ac)2 were mixed in three-necked flask. Then as-prepared TOPO- capped CdSe nanocrystals in chloroform was added to the mixture and the temperature was increased to the</p><p> desired temperature quickly. The desired stock solution of TOP/S prepared by adding 0.1 mL (TMS) 2S to 3 mL</p><p>TOP was added at 1 mL/min. In the following 2 h, the temperature was maintained at 90 °C to keep the inorganic epitaxial growth of the shell to proceed on the surface of the core. QDs with emission wavelength</p><p>(612 nm) were synthesized.</p><p>Preparation of GSH stabilized QDs </p><p>GSH stabilized QDs were synthesized based on the previously reported procedures of the exchange of TOPO on the surface of as-synthesized QDs by GSH (Freeman et al. 2010). QDs were dissolved in chloroform, to which a</p><p>100 μL GSH solution (containing 0.142 g GSH and 40 mg KOH in 2 ml methanol) was added followed by vigorous shaking. After the addition of 1.5 ml NaOH aqueous solution (1 mM), the top aqueous layer was separated and precipitated with NaCl and methanol to remove excess GSH. The resulting QDs were dissolved in</p><p>500 μL borate buffer (pH 8.5, 10 mM). The concentration of QDs was measured based on the previously reported method (Yu et al. 2003). The transmission electron microscopy (TEM) images of QDs were obtained using a transmission electron microscope (Tecnai G2 20, FEI, Netherlands). For hydrodynamic diameter</p><p>2 analyses, the size distribution of QD and QDs-(SpeA)8 were determined by a Nano ZS90 (Malvern, UK) according to a dynamic light scattering (DLS) technique at 25 ºC.</p><p>Protein sequence of SpeA</p><p>The concentration of SpeA was determined by UV spectrophotometry at 280 nm using the absorption coefficient factor 27810 cm-1 M-1 as calculated from the contents of tyrosine, tryptophan, and cysteine in the SpeA sequence.</p><p>HMDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMA</p><p>TLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKK</p><p>MVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETL</p><p>DSNTSQIEVYLTTK (without N-terminal His-Tag).</p><p>Fig. S1. LC-MS of SpeA.</p><p>3 Fig. S2. TEM images of QDs.</p><p>(A)</p><p>Size Dis tribution by Num ber</p><p>30 )</p><p>% 20 (</p><p> r e b m</p><p> u 10 N</p><p>0 0.1 1 10 100 1000 10000 Size (d.nm )</p><p>Record(B) 118: wang-2 1</p><p>Size Distribution by Number</p><p>40</p><p>) 30 % (</p><p> r e</p><p> b 20 m u</p><p>N 10</p><p>0 0.1 1 10 100 1000 10000 Size (d.nm )</p><p>Fig. S3. DLS analysis of QDs (with an average diameterRecord 120: wang-4of 7.5 1 nm) (A) and QD-(SpeA)8 (with an average diameter of 11.6 nm) (B).</p><p>References</p><p>Freeman R, Finder T, Gill R, Willner L (2010) Probing protein kinase (CK2) and alkaline phosphatase with</p><p>CdSe/ZnS quantum dots. Nano Lett 10:2192–2196</p><p>Peng Z A, Peng X (2001) Formation of high-quality CdTe, CdSe, and CdS nanocrystals using CdO as precursor.</p><p>J Am Chem Soc 123:183–184</p><p>Qu L, Peng Z A, Peng X (2001) Alternative routes toward high quality CdSe nanocrystals. Nano Lett 1 333–337</p><p>4 Yu W W, Qu L, Guo W, Peng X (2003) Experimental Determination of the Extinction Coefficient of CdTe,</p><p>CdSe, and CdS Nanocrystals. Chem Mater 15:2854–2860</p><p>5</p>

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    5 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us