MUTED antibody - C-terminal region (ARP63301_P050) Data Sheet Product Number ARP63301_P050 Product Name MUTED antibody - C-terminal region (ARP63301_P050) Size 50ug Gene Symbol BLOC1S5 Alias Symbols DKFZp686E2287; MU; MUTED Nucleotide Accession# NM_201280 Protein Size (# AA) 187 amino acids Molecular Weight 21kDa Product Format Lyophilized powder NCBI Gene Id 63915 Host Rabbit Clonality Polyclonal Official Gene Full Name Muted homolog (mouse) Gene Family BLOC1S This is a rabbit polyclonal antibody against MUTED. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Partner Proteins BLOC1S2,DTNBP1,BLOC1S1,BLOC1S2,CNO,DTNBP1,SNAPIN,BLOC1S2,BLOC1S3,DTNBP1,PLDN,SQS TM1,YOD1 This gene encodes a component of BLOC-1 (biogenesis of lysosome-related organelles complex 1). Components of this complex are involved in the biogenesis of organelles such as melanosomes and platelet- Description of Target dense granules. A mouse model for Hermansky-Pudlak Syndrome is mutated in the murine version of this gene. Alternative splicing results in multiple transcript variants. Read-through transcription exists between this gene and the upstream EEF1E1 (eukaryotic translation elongation factor 1 epsilon 1) gene, as well as with the downstream TXNDC5 (thioredoxin domain containing 5) gene. Blocking Peptide For anti-MUTED antibody is Catalog # AAP63301 Lead Time Domestic: within 24 hours delivery International: 3-5 business days Peptide Sequence Synthetic peptide located within the following region: QQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMER Reconstitution and Add 50 ul of distilled water. Final anti-MUTED antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Swissprot Id Q8TDH9 Protein Name Biogenesis of lysosome-related organelles complex 1 subunit 5 Sample Type Confirmation BLOC1S5 is supported by BioGPS gene expression data to be expressed in HeLa Protein Accession # NP_958437 Purification Affinity Purified Species Reactivity Human, Horse, Rabbit, Mouse, Bovine, Rat, Dog, Guinea pig Application WB Predicted Homology Based on Immunogen Human: 100%; Horse: 86%; Rabbit: 86%; Mouse: 85%; Dog: 79%; Rat: 79%; Bovine: 79%; Pig: 77%; Guinea pig: 77% Sequence Human HeLa WB Suggested Anti-MUTED Antibody Titration: 1.0 ug/ml Titration: 1.0 ug/ml Positive Control: Hela Whole Cell BLOC1S5 is supported by BioGPS gene expression data to be expressed in HeLa Image 1 __________________________________________________________________________________________________________________________________________________________________ This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users..