(12) United States Patent (10) Patent No.: US 9,359,581 B2 Ness Et Al

(12) United States Patent (10) Patent No.: US 9,359,581 B2 Ness Et Al

US009359581B2 (12) United States Patent (10) Patent No.: US 9,359,581 B2 Ness et al. (45) Date of Patent: *Jun. 7, 2016 (54) BIOTRANSFORMATION USING CI2N 5/8 (2006.01) GENETICALLY MODIFIED CANDIDA CI2N 9/04 (2006.01) (52) U.S. Cl. (71) Applicant: Synthezyme, LLC, Rensselaer, NY CPC .............. CIIC3/006 (2013.01); C12N 9/0006 (US) (2013.01); C12N 15/815 (2013.01): CI2P 7/6409 (2013.01): CI2P 7/649 (2013.01): CI2P (72) Inventors: Jon E. Ness, Redwood City, CA (US); 7/6427 (2013.01); C12P 7/6436 (2013.01); Jeremy Minshull, Palo Alto, CA (US) Y02E 50/13 (2013.01); Y02P 20/52 (2015.11) (58) Field of Classification Search (73) Assignee: Synthezyme LLC, Rensselaer, NY (US) None See application file for complete search history. (*) Notice: Subject to any disclaimer, the term of this patent is extended or adjusted under 35 (56) References Cited U.S.C. 154(b) by 0 days. U.S. PATENT DOCUMENTS This patent is Subject to a terminal dis claimer. 8, 158,391 B2 * 4/2012 Gross et al. ................... 435.134 (21) Appl. No.: 14/084.230 OTHER PUBLICATIONS Chica et al. Curr Opin Biotechnol. Aug. 2005:16(4):378-84.* (22) Filed: Nov. 19, 2013 Sen et al. Appl Biochem Biotechnol. Dec. 2007: 143(3):212-23.* (65) Prior Publication Data * cited by examiner US 2015/OO94483 A1 Apr. 2, 2015 Primary Examiner — Christian Fronda Related U.S. Application Data (74) Attorney, Agent, or Firm — Laurence P. Colton; Smith Tempel Blaha LLC (60) Division of application No. 12/775,306, filed on May 6, 2010, now Pat. No. 8,597,923, which is a (57) ABSTRACT SENNES applit s 2,672). A substantially pure Candida host cell is provided for the yo, s • L vs. 8 Y-s u a- als--- u • biotransformation of a substrate to a product wherein the host (60) Provisional application No. 61/176,064, filed on May cell is characterized by a first genetic modification class that 6, 2009. comprises one or more genetic modifications that collectively or individually disrupt at least one alcohol dehydrogenase (51) Int. Cl. gene in the Substantially pure Candida host cell. CI2P 7/64 (2006.01) CIIC3/00 (2006.01) 33 Claims, 28 Drawing Sheets U.S. Patent Jun. 7, 2016 Sheet 1 of 28 US 9,359,581 B2 Fatty Acid rt-NS Fatty Acid Fatty Acid CYP52AType P450 s COAOxidase O-HO-Fatty Acid (B-unsaturated fatty acyl CoA Fatty Alcohol Oxidase CYP52A Type P450 Hydratase OCH-Fatty Acid 3-hydroxy fatty-acyl CoA Dehydrogenase CYP52A Type P450 Dehydrogenase HOOC-Fatty Acid B-OXO fatty-acyl CoA Thiolase Fatty-acyl COA+ Acetyl CoA Figure U.S. Patent Jun. 7, 2016 Sheet 2 of 28 US 9,359,581 B2 Fatty Acid a-Oxidation s B-Oxidation s s is s 8. i. Fatty Acid Fatty Acid CYP52AType P450 X ApOX4 ApOx5 (strain DP1) y C-HO-Fatty Acid 0.8-unsaturated fatty acyl COA Fatty Alcohol Oxidase CYP52A Type P450 Hydratase y OCH-Fatty Acid 3-hydroxy fatty-acyl CoA Dehydrogenase CYP52A Type P450 Dehydrogenase s HOOC-Fatty Acid 8-OXO fatty-acyl CoA Thiolase Fatty-acyl CoA+ Acetyl CoA Figure2 U.S. Patent Jun. 7, 2016 Sheet 3 of 28 US 9,359,581 B2 albicans DH 1A MSLFRIFRGASLTTTTASFTATTGATT.KTLS GSTWLRKSYKRTYSSSWLSSFE albicans ADH 1E MERFFRIFEGGSLTTTTSFTTTGTTTLSGSTWLREEERTESSSWLSSPE tropicalis ADE 4 albicans ADH 24. albicans ADH 2B tropicalis ADH B4 trialis DH 1 tropicalis ADHB11 albicans DH 1A LFFFHFINNERYCHTTTTTNTRTIMSEIFETEAWWFDTNGGOLWYKDYPWPTFEERIE albicans DH 1E LFFFHOFINNERYCHTTTTTNTETIMSEQIPETEAWWFDTNGGOLWYEDYFWPTFEPTE tropicalis ADH 44 ELEYEDIPWRTREME albicans ADH 2A MSWFTTE WIFETIGGELEYEDIFFFERENE albicans DH 2B MSWFTTEAWIFETNGGKLEYEDIPWPKPKANE tropicalis ADH B4 LEEDIPWREPERIE ... tropicalis ADH 10 . KLEYEDWPWPWPEPE tropicalis ADHB11 FLYTDIPWPWPKFNE it fit fit fit, it albicans DH 1A LLIHESGHTILHWEGDWPLTELPLGGHEGGGGEEGWEIGDFGIEW albicans DE 1B LLINESSWCHTILHiWRGITVPLTELPLWGGHEGGGGEEGWEIGIF,GIEW tropicalis ADH 4 LLINKSGHTILHWEGIWFLTELFLGGHEGGGGEEGWEIGDFGIEW allian8 ADH 2. LLINESGHTILHWEGIWFLTELFLGGHEGFLGENEGWEGD, albicans ADH2B LLINESGCHTILHWRGITFLTELFLGGHEGGS WILGEMWKGWEGIGWEW ... tropicalis DH B4 LLINESGCHTILHWEGIWFLITELPLGGHEGGIGINEGWEGILGW tropicalis ADH.10 L LRESGCHSDLHTTEGDWFIFELFLGGHEGGGMGNREGTEGDLGIET tropicalis ADH Bll LLYHWESGWCHSDIHWWEGIWFPSELFWGGHEGGWWIGENWGWEWGDL.GIEM * f : . it it if it if f : * : * * * * * * : * * * : h if f it it if it it. if it; if it if f it: it albicans ADH 1A LNGSCMSCEFCOGEFNCGEDLSGTHDGSFETDAW, EIFGTILITAFIL albicans DH 1E LNGSCMSCEFCOGEFMCGEDLSGTHIGSFETDAWKIFAGTDLMWFIL tropicalis ADH 4 LNGSCMSCEFCOGEFMCGEDLSGTHIGSFETDAWRIPTILEWPIL albicans ADH2A LNGSCLNCEYCSGAEFNCEADLSGYTHIGSFQYATA DAN, RIPAGTDLANWAFIL albicans ADH 2B LNGSCLNCECSGAEFNCEDLSGTHIGSFYIT.I.W.RIPEGTILITAFIL ... tropicalis ADH B4 LNGSCMICEYCOOGEPNCPO, DLSGTHIGSFOOTDRIP, GTDLNWPIL tropicalis DH.10 LNGSCMICEFCOGAEFNCSRADMSG THDGTFOYATADAWKIPEGDMASIAFIL tropicalis ADH Bll LNGSCMNCEYCOGAEPMCPHDWSGSHDGTFYTD.W.EFPGSDLSIPIS * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * allians DH 1. CGTELETILGWISGGGGLGSLWORMGLRWIGGIEEGEFE albicans DH1B CGTWELETILGWISGGGGLGSLWYARMGLRWIDGGDEKGEFE tropicalis ADH 4 CGTELETILGISGGGLSLOWMGLRIGGIEEGFE albicans DH 2A C.G.T.YKALETELEGOWAISG. AGGLGSLWYAKMGYRLAIDGGEDKGEFWES albicans DH 2E CGITELETELEGISGIGGLGSLW.E.MGR LIDGGEDEGEFE Figure 3A U.S. Patent Jun. 7, 2016 Sheet 4 of 28 US 9,359,581 B2 C topicalis ADE E4 GWTWELETEDLFNISG, GLSLWEMGRWIDGGEGEFE C tropicalis ADE 10 CAGSTWELENADLLAGOT...ISGGGGLGSLGWE, MGRWLAIDGGIERGEFWE , tropicalis ADE B11 GWTWELET GLOFWISG, GLSLEMGLRWIGGERFES * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * C albicans ADH 14. LGENDFTEDEDIWEWEETIGGRHGINESSEEIDSWEWRFLGWWLWGLP. albicans ADH 1E LG EASWDFTEIRDIYESERTIGGPHGAINSYSERIDSWEEWRFLGRWLWGLFA topicalis ADE 44 LEIDFLEEEDIWSWEETIGGFHINESSEEISEWRFLGELLP albicans ADH2A LGETFIDFTEEEDWWE WEETINGGPHGWINSWSERIGOSTEYWRTLGEWWLWGLPA albicans ADH2E LGETFIDFTEEEDWWE WEETINGGFHGWINSWSERIGOSTE WRTLG&WLWGLFA tIOpicalis ADF E4 LGAEWFWDFL.EEEDIWGWEKATIGGRHGWNYSISEEINSWDWRTLGEWWLWGLFA , tropicalis DH 1. LGAEYYIDFLEEDIYSIRRATGGGFHGWINSWSEEINSWEWRTLGKWWLWSLFA tropicalis ADEE 11 LGAEWFWDFTEEANYSEIIRATIGGAHGSINESISEEINSWEEWRTLGTWLWGLPA * * * * * * * : ; ; t; fift fit; if it: k, t, if it, if t if f it? C albicans ADH 1A HETPWFIWWESIEIGSEGNREITEIDFFSRGLIECPIKIWGLSDLPEFELM C albicans ADH 1E HETPWFD WESIEIRGSGNREDTEIDFFSRGLIECPIEIWGLSDLPEFELE C tIOpialis DH GSEWTGWFEWWESIEIEGSYWGNREDTENDFFSRGLIECFIEIWGLSELFWFELM C albicans TH 2. GART3TPWFD WIFTIOIRGSYWGNRRDTAE ANDFFTRG, IRCFTRIWGLSELPEWYRLY allicans ADH2E GAEISTFWFD WIETIIEGSYNGNREDTAETIFFTRGLIECFIKIWGLSELFEWELE C , tropicalis ADF E4 GSEWSFWFDSWWESIQIEGSYWGNREDTESDFFSRGLIECFIEWGLSELFEWYELM C tIOpicalis ADE 10 GGELTPLFESWARSIOIRTTCWGNREDTTEIDFFWRGLIDCPIKWGLSEWPEIFILM tropicalis ADE B11 ELEFIFMSAEIIRGSYNNRRDTAEWDFFARGLWECFIEWGLSELFEIFELL f; ; ; ; ; ; ; ; f : h : h if it; it fifth if it? fift fit fift f ; ; ; ; ; ; , f : C. albicans ADH 1, EEGEILSRYWLITS-SEC ID MO; 72 C. albicans ADH 1B EEGRILGRYWLITSE SEC ID MO; 173 C. tropicalis ADH4 --------------- SE ID MO; 155 C. albicans ADH2. EEGRILGRYWLINDE SEO, ID MO; 174 C, albicans ADH 2B EEGKILGRLINK SE II MO; 175 C. tropicalis ADH E4 -------------- SE ID MO;154 C. tropicalis ADH 10 -------------- SE ID MO; 152 C. tropicalis ADH E 11 -------------- SE II MO; 151 Figure3B U.S. Patent Jun. 7, 2016 Sheet 5 of 28 US 9,359,581 B2 ReCOmbinase ReCOmbinase Site Site Targeting Recombinase Targeting Sequence enCOding gene Selective marker Sequence Restriction site to release targeting Restriction site to release targeting Construct from Sequences required for Construct from Sequences required for bacterial propagation bacterial propagation Figure 4 U.S. Patent Jun. 7, 2016 Sheet 6 of 28 US 9,359,581 B2 ReCOmbinase ReCOmbinase site Targeting COnstruct site Targeting Recombinase Targeting Sequence 1 enCOding gene Selective marker Z8 : TargetW: TargetNEB Sequence 1 Sequence 2 GenOmic DNA DNA region to be replaced HomologOUS recombination Integrant W ''''''''''''''''''''''^ ReCOmbinase GenOmic DNA enCOding gene Selective marker ReCOmbinase ReCOmbinase Site Site EXCised DNA W: N D Figure 5 U.S. Patent Jun. 7, 2016 Sheet 7 of 28 US 9,359,581 B2 ReCOmbinase ReCOmbinase Site Site ReCOmbinase encoding gene Selective marker Z8E0 N A GenOmic DNA Induction of reCOmbinase ReCOmbinase WXNE B : GenOmic DNA ReCOmbinase Recombinase site encoding gene Selective marker U.S. Patent Jun. 7, 2016 Sheet 8 of 28 US 9,359,581 B2 Insertion Sequences ReCOmbinase ReCOmbinase site Site Targeting Recombinase Targeting Sequence encoding gene Selective marker Sequence WIO E.8%:W.III E: Restriction site to release targeting Restriction site to release targeting construct from sequences required for Construct from sequences required for bacterial propagation bacterial propagation Figure 7 U.S. Patent Jun. 7, 2016 Sheet 9 of 28 US 9,359,581 B2 Insertion ReCOmbinase ReCOmbinase Sequences Targeting COnstruct Site Site Targeting Recombinase Targeting Sequence? encoding gene Selective marker eCuence 2 W| EN A : Target Target Sequence Sequence 2 Genomic DNA DNA region to be replaced Homologous recombination Insertion Sequence Integrant EWIE8Ex ReCOmbinase GenOmic DNA enCOding gene Selective marker ReCOmbinase ReCOmbinase Site site EXCISec DNA U.S. Patent Jun. 7, 2016 Sheet 10 of 28 US 9,359,581 B2 ReCOmbinase ReCOmbinase Site Site ReCOmbinase encoding gene Selective marker EZIEEEx:N Genomic DNA \""Sequences Induction OfreCOmbinase Insertion Sequences ReCOmbinase WIEX NE B GenOmic DNA Recombinase ReCombinase site enCOding gene Selective marker Figure 9 U.S. Patent Jun. 7, 2016 Sheet 11 of 28 US 9,359,581 B2 Original genomic sequence Target Sequence

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    236 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us