B01P) Gene Alias: IME4, M6A, MGC4336, MT-A70, Spo8

B01P) Gene Alias: IME4, M6A, MGC4336, MT-A70, Spo8

METTL3 purified MaxPab mouse Gene Symbol: METTL3 polyclonal antibody (B01P) Gene Alias: IME4, M6A, MGC4336, MT-A70, Spo8 Catalog Number: H00056339-B01P Gene Summary: This gene encodes the 70 kDa subunit of MT-A which is part of Regulatory Status: For research use only (RUO) N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal Product Description: Mouse polyclonal antibody raised adenosine residues in eukaryotic mRNAs, forming against a full-length human METTL3 protein. N6-methyladenosine. [provided by RefSeq] Immunogen: METTL3 (NP_062826.2, 1 a.a. ~ 580 a.a) References: full-length human protein. 1. Synaptic N6-methyladenosine (m6A) epitranscriptome Sequence: reveals functional partitioning of localized transcripts. MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLR Merkurjev D, Hong WT, Iida K, Oomoto I, Goldie BJ, NPEAALSPTFRSDSPVPTAPTSGGPKPSTASAVPELAT Yamaguti H, Ohara T, Kawaguchi SY, Hirano T, Martin DPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQ KC, Pellegrini M, Wang DO. Nat Neurosci. 2018 DGVESLLQKFAAQELIEVKRGLLQDDAHPTLVTYADHS Jul;21(7):1004-1014. doi: 10.1038/s41593-018-0173-6. KLSAMMGAVAEKKGPGEVAGTVTGQKRRAEQDSTTV Epub 2018 Jun 27. AAFASSLVSGLNSSASEPAKEPAKKSRKHAASDVDLEI 2. The RNA Methyltransferase Complex of WTAP, ESLLNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKF METTL3, and METTL14 Regulates Mitotic Clonal RSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFR Expansion in Adipogenesis. Kobayashi M, Ohsugi M, RIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMD Sasako T, Awazawa M, Umehara T, Iwane A, Kobayashi SEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQWIC N, Okazaki Y, Kubota N, Suzuki R, Waki H, Horiuchi K, CDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDE Hamakubo T, Kodama T, Aoe S, Tobe K, Kadowaki T, MRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGY Ueki K. Mol Cell Biol. 2018 Jul 30;38(16). pii: e00116-18. ERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGV doi: 10.1128/MCB.00116-18. Print 2018 Aug 15. KGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLS 3. A Unique ISR Program Determines Cellular PGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVA Responses to Chronic Stress. Guan BJ, van Hoef V, RFKQRYPDGIISKPKNL Jobava R, Elroy-Stein O, Valasek LS, Cargnello M, Gao XH, Krokowski D, Merrick WC, Kimball SR, Komar AA, Host: Mouse Koromilas AE, Wynshaw-Boris A, Topisirovic I, Larsson O, Hatzoglou M. Mol Cell. 2017 Dec 7;68(5):885-900.e6. Reactivity: Human Applications: IF, WB-Ti, WB-Tr (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Storage Buffer: In 1x PBS, pH 7.4 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 56339 Page 1/1 Powered by TCPDF (www.tcpdf.org).

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    1 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us