CEP350 Monoclonal Antibody, Clone CL3423

CEP350 monoclonal antibody, clone Entrez GeneID: 9857

CL3423 Gene Symbol: CEP350

Catalog Number: MAB15801 Gene Alias: CAP350, FLJ38282, FLJ44058, GM133, KIAA0480 Regulatory Status: For research use only (RUO) Gene Summary: The product of this gene is a large Product Description: Mouse monoclonal antibody protein with a CAP-Gly domain typically found in raised against partial recombinant human CEP350. cytoskeleton-associated proteins. The encoded protein primarily localizes to the centrosome, a Clone Name: CL3423 non-membraneous organelle that functions as the major Immunogen: Recombinant protein corresponding to microtubule-organizing center in animal cells. The human CEP350. encoded protein directly interacts with another large centrosomal protein and is required to anchor Sequence: microtubules at the centrosome. It is also implicated in QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQI the regulation of a class of nuclear hormone receptors in CEMAELTRTHISDAVVASGAPLAILYDHQRQHLPDFVK the nucleus. Several alternatively spliced transcript QLRTRTETDRKSPSVSLSQ variants have been found, but their full-length nature has not been determined. [provided by RefSeq] Host: Mouse

Reactivity: Human

Applications: IF, IHC-P (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Form: Liquid

Purification: Protein A purification

Isotype: IgG1

Recommend Usage: Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user.

Storage Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).

Storage Instruction: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.

Page 1/1