Table of Contents 1
2004-2005 ...... 3 Student Handbook, 17 2005-2006 ...... 4 'H¿DQFH&ROOHJH&DPSXV&RYHQDQW Career and Student Assistance, 17 General Information ...... 5 $FDGHPLF$GYLVLQJ History, 5 7XWRULQJDQG2WKHU$FDGHPLF6XSSRUW6HUYLFHV Mission Statement, 5 Accommodations Policy for Students with Educational Philosophy, 5 Disabilities, 18 Learning Outcomes, 6 Academic and Honor Societies, 18 Assessment, 7 &LYLO5LJKWV5DFLDO+DUDVVPHQW3ROLF\ Accreditation, 7 Commencement, 18 8&&$I¿OLDWLRQ Computer Policy, 18 Non-discrimination Statement, 7 Sexual/Gender Harassment Statement, 18-19 Student Complaint Policy, 7 3LOJULP/LEUDU\6HUYLFHV Admission...... 8 Academic Life ...... 20 Campus Visit, 8 Academic Year, 20 How to Apply, 8 Summer Session, 20 Admission Requirements, 8 (YHQLQJ6HVVLRQ International Student Admission, 9 Center for Adult & Graduate Programs, 20 Student Re-Enrollment, 9 Graduate Programs, 20 Transient Student Admission, 9 Baccalaureate Curriculum, 21 Post-Secondary Enrollment Options, 9 Associate Degree Curriculum, 21 Admission Criteria, 9 Graduation Requirements ...... 22 Admission Decision, 9-10 Associate of Arts Degree Requirements, 22 Tuition Deposit, 10 Baccalaureate Degree Requirements, 22-23 Costs ...... 11 Baccalaureate General Education Requirements, 23 Tuition, Room and Board, 11 Special Academic Programs ...... 24 Other Fees and Charges, 11 On Campus Program Options: Financial Policies ...... 12 7KH0F0DVWHU6FKRROIRU$GYDQFLQJ+XPDQLW\ International Student Admission, 9, 12 Honors Program, 24 Prepayment of Tuition, 12 Pre-Professional Programs, 24 Payment of Accounts, 12 $GYDQFHG3ODFHPHQW&UHGLW Deferred Payments, 12 Transfer Credit, 25 Schedule of Payments, 12 Non-Traditional Credit, 25-26 Financial Status, 12 Independent Study, 26 Refund Policy, 12-13 Off-campus Academic Programs: Financial Aid...... 14 6HUYLFH/HDUQLQJ Application, 14 &RRSHUDWLYH(GXFDWLRQ Renewal, 14 Internships, 27 Aid Categories, 14-15 Field Experience, 27 Enrollment and Eligibility, 15 Study Abroad, 27 Financial Aid Policies, 15 Academic Policies ...... 28 Outside Scholarships, 15 Class Standing, 28 Satisfactory Academic Progress, 15-16 Course Load, 28 Student Life ...... 17 Auditing Courses, 28 Class Attendance, 28 Table of Contents 2
Registration, 28 Life Science and Chemistry, 42-43 Schedule Changes and Withdrawals, 28-29 Management, 43 Grading System, 29 Marketing, 43-44 0LOLWDU\$FWLYH'XW\ Mathematics, 44 Pass-Fail Option, 29 Medical Technology, 44 Academic Second Chance, 29 Multi-Media Communication, 44-45 Graduate/Undergraduate Course Policy, 29 Music, 45 Academic Appeals, 29 Natural Science, 45 Grade Reports, 30 2UJDQL]DWLRQDO/HDGHUVKLSDQG6XSHUYLVLRQ &RQ¿GHQWLDOLW\RI6WXGHQW5HFRUGV Physical Education, 45-46 Transcript Requests, 30 Physics, 46 Academic Probation, 30 Political Science, 46 Athletic Eligibility, 30 Psychology, 46 Academic Honors, 30-31 Recreation, 46 Majors & Requirements ...... 31 Religious Studies, 'LYLVLRQ6WUXFWXUH Religious Education and Christian Education, 46-49 Accounting, 31 Restoration Ecology, 49 Art, 32 Social Work, 49-50 Arts & Humanities, 32 Sociology, 50 Athletic Training Education, 32-33 Spanish, 50 Biology, 33 Sport Management, 50-51 Business, 33 Sport Science, 51 Business Administration, 34 Visual Arts, 51 Chemistry, 34 Wellness, 52 Christian Education, 34 Communication Arts, 34-35 Course Descriptions ...... 53-86 Criminal Justice, 35 Directory ...... 87-89 Design for Leadership, 35 Index ...... 90-94 Economics, 35-36 Education, 36-38 English, 38 (QYLURQPHQWDO6FLHQFH Finance, 38-39 Forensic Science, 39 General Studies, 39 Geography, 39 Graphic Design, 39 Health Education, 39 History, 40 Human Resource Management, 40 Information Technology, 40-41 Integrated Language Arts, 41 Integrated Mathematics, 41-42 Integrated Social Studies, 42 Life Science, 42 2004-2005 Calendar 3
FALL SEMESTER 2004 Weekend College New Student Orientation Saturday, August 21 New Faculty Orientation Tuesday, August 24 Faculty Workshop Wednesday – Friday, August 25-27 Weekend College Courses Begin Friday August 27 5HJLVWUDWLRQDQG(YHQLQJ&ODVVHV%HJLQ 8QGHUJUDGXDWH *UDGXDWH 0RQGD\$XJXVW 'D\&ODVVHVDQG/DEV%HJLQ 8QGHUJUDGXDWH *UDGXDWH 7XHVGD\$XJXVW Late Registration Ends at 6:30 p.m. Thursday, September 2 Last Day to Drop/Add Courses Thursday, September 2 /DERU'D\+ROLGD\ 1R&ODVVHV 0RQGD\6HSWHPEHU Midterm Thursday, October 14 0LGWHUP%UHDN 1R&ODVVHV 7KXUVGD\1LJKW&ODVVHV0HHW )ULGD\2FWREHU Midterm Grades Due by 12 NOON Tuesday, October 19 Last Day to Withdraw with an Automatic “W” Thursday, October 29 )DFXOW\'HYHORSPHQW'D\ 1R&ODVVHV 7XHVGD\1LJKW&ODVVHV0HHW :HGQHVGD\1RYHPEHU 7KDQNVJLYLQJ9DFDWLRQ 7KXUVGD\ )ULGD\1RYHPEHU &ODVVHV5HVXPHDW DP 0RQGD\1RYHPEHU Last Day of Classes for Weekend College Courses Saturday, December 4 /DVW'D\RI&ODVVHV 8QGHUJUDGXDWH *UDGXDWH )ULGD\'HFHPEHU Final Examinations Monday - Thursday, December 13-16 Grades Due by 12 NOON Monday, December 20 2I¿FHV&ORVHGIRU&KULVWPDV%UHDN )ULGD\'HFHPEHU±)ULGD\'HFHPEHU
SPRING SEMESTER 2005 2I¿FHV5HRSHQ 0RQGD\-DQXDU\ Weekend College New Student Orientation Saturday, January 8 5HJLVWUDWLRQDQG(YHQLQJ&ODVVHV%HJLQ 8QGHUJUDGXDWH *UDGXDWH 0RQGD\-DQXDU\ 'D\&ODVVHVDQG/DEV%HJLQ 8QGHUJUDGXDWH *UDGXDWH 7XHVGD\-DQXDU\ Late Registration Ends at 6:30 p.m. Thursday, January 13 Last Day to Drop/Add Courses Thursday, January 13 Weekend College Courses Begin Friday, January 14 0DUWLQ/XWKHU.LQJ+ROLGD\ 1R&ODVVHV±2I¿FHV&ORVHG 0RQGD\-DQXDU\ Midterm Thursday, March 3 Midterm Grades Due by 12 NOON Monday, March 7 Spring Vacation Begins at Close of Classes Friday, March 11 Classes Resume at 8:00 a.m. Monday, March 22 Last Day to Withdraw from Class with Automatic “W” Wednesday, March 23 *RRG)ULGD\+ROLGD\ 1R&ODVVHV 7KXUVGD\1LJKW&ODVVHV0HHW )ULGD\0DUFK Last Day of Classes for Weekend College Courses Saturday, April 16 +RQRUV&RQYRFDWLRQ 6XQGD\$SULO /DVW'D\RI&ODVVHV 8QGHUJUDGXDWH *UDGXDWH )ULGD\$SULO Final Examinations Monday – Thursday, May 2-5 Commencement Sunday, May 8 Grades Due at 12 NOON Wednesday, May 11
SUMMER SCHEDULE 2005
Weekend College New Student Orientation Saturday, May 7 Weekend College Courses Begin Friday, May 13 Summer Session I May 16 – June 17 0HPRULDO'D\+ROLGD\ 1R&ODVVHV 0RQGD\0D\ Summer Session II June 20-July 22 Independence Day Monday, July 5 Summer Session III July 25-August 12 2005-2006 Calendar 4
FALL SEMESTER 2005 Weekend College New Student Orientation Saturday, August 27 New Faculty Orientation Tuesday, August 23 Faculty Workshop Wednesday – Friday, August 24-26 Weekend College Courses Begin Friday September 9 5HJLVWUDWLRQDQG(YHQLQJ&ODVVHV%HJLQ 8QGHUJUDGXDWH *UDGXDWH 0RQGD\$XJXVW 'D\&ODVVHVDQG/DEV%HJLQ 8QGHUJUDGXDWH *UDGXDWH 7XHVGD\$XJXVW Late Registration Ends at 6:30 p.m. Thursday, September 1 Last Day to Drop/Add Courses Thursday, September 1 /DERU'D\+ROLGD\ 1R&ODVVHV 0RQGD\6HSWHPEHU Midterm Tuesday, October 18 0LGWHUP%UHDN 1R&ODVVHV 7KXUVGD\1LJKW&ODVVHV0HHW )ULGD\2FWREHU Midterm Grades Due by 12 NOON Monday, October 24 Last Day to Withdraw with an Automatic “W” Monday, October 31 )DFXOW\'HYHORSPHQW'D\ 1R&ODVVHV 7XHVGD\1LJKW&ODVVHV0HHW :HGQHVGD\1RYHPEHU 7KDQNVJLYLQJ9DFDWLRQ 7KXUVGD\ )ULGD\1RYHPEHU &ODVVHV5HVXPHDW DP 0RQGD\1RYHPEHU /DVW'D\RI&ODVVHV 8QGHUJUDGXDWH *UDGXDWH )ULGD\'HFHPEHU Last Day of Classes for Weekend College Courses Saturday, December 17 Final Examinations Monday - Thursday, December 12-15 Grades Due by 12 NOON Monday, December 19 2I¿FHV&ORVHGIRU+ROLGD\%UHDN 0RQGD\'HFHPEHU±)ULGD\'HFHPEHU
SPRING SEMESTER 2006 2I¿FHV5HRSHQ 0RQGD\-DQXDU\ Weekend College New Student Orientation Saturday, January 7 5HJLVWUDWLRQDQG(YHQLQJ&ODVVHV%HJLQ 8QGHUJUDGXDWH *UDGXDWH 0RQGD\-DQXDU\ 'D\&ODVVHVDQG/DEV%HJLQ 8QGHUJUDGXDWH *UDGXDWH 7XHVGD\-DQXDU\ Late Registration Ends at 6:30 p.m. Thursday, January 12 Last Day to Drop/Add Courses Thursday, January 12 Weekend College Courses Begin Friday, January 13 0DUWLQ/XWKHU.LQJ+ROLGD\ 1R&ODVVHV±2I¿FHV&ORVHG 0RQGD\-DQXDU\ Midterm Wednesday, March 1 Midterm Grades Due by 12 NOON Monday, March 6 Spring Vacation Begins at Close of Classes Friday, March 10 Classes Resume at 8:00 a.m. Monday, March 20 Last Day to Withdraw from Class with Automatic “W” Monday, March 20 *RRG)ULGD\+ROLGD\ 1R&ODVVHV 7KXUVGD\1LJKW&ODVVHV0HHW )ULGD\$SULO Last Day of Classes for Weekend College Courses Saturday, April 22 +RQRUV&RQYRFDWLRQ 6XQGD\$SULO /DVW'D\RI&ODVVHV 8QGHUJUDGXDWH *UDGXDWH )ULGD\$SULO Final Examinations Monday – Thursday, May 1-4 Commencement Sunday, May 7 Grades Due at 12 NOON Wednesday, May 10
SUMMER SCHEDULE 2006
Weekend College New Student Orientation Saturday, May 6 Weekend College Courses Begin Friday, May 12 Summer Session I May 15 – June 16 0HPRULDO'D\+ROLGD\ 1R&ODVVHV 0RQGD\0D\ Summer Session II June 19-July 21 Independence Day Tuesday, July 4 Summer Session III July 24-August 11 General Information 5
7KH&ROOHJHUHVHUYHVWKHULJKWWRPDNHFKDQJHVDVUHTXLUHGLQ TO UNDERSTAND course offerings, curricula, academic policies and other rules :HSURYLGHRSSRUWXQLWLHVIRUVWXGHQWVWRSHUFHLYHDQGPDNH DQGUHJXODWLRQVDIIHFWLQJVWXGHQWVWREHHIIHFWLYHZKHQHYHU connections between the intellectual realm and the world. GHWHUPLQHGE\WKH&ROOHJH7KHVHFKDQJHVZLOOJRYHUQDOOFXUUHQW :HVWULYHWRGHYHORSDZDUHQHVVRIDQGVHQVLWLYLW\WRJOREDO and formerly enrolled students. LQWHUGHSHQGHQFHDQGGLYHUVHFXOWXUHV
7KH&ROOHJHDOVRUHVHUYHVWKHULJKWWRUHTXLUHZLWKGUDZDORIDQ\ TO LEAD VWXGHQWDWDQ\WLPHIRUUHDVRQVGHHPHGVXI¿FLHQWWKDWZLOOPRVW We are committed to the betterment of the community, the nation, HIIHFWLYHO\SURWHFWWKHZHOIDUHRILWVVWXGHQWVDQGWKHLQWHUHVWVRI DQGWKHZRUOGWKURXJKWKHGHYHORSPHQWRIOHDGHUVKLSVNLOOV the College. and abilities. We create opportunities for students to initiate DQGIDFLOLWDWHEHQH¿FLDODFWLRQLQDQGRXWRIWKHFODVVURRPDQG History HQFRXUDJHVHOIUHÀHFWLRQRQWKHUROHRIWKHGHGLFDWHGOHDGHU 7KHKLVWRU\RI'H¿DQFH&ROOHJHLVDVULFKDQGGLVWLQFWLYHDV the area in which it is located. Attacks on pioneer settlements TO SERVE SURPSWHG5HYROXWLRQDU\:DUKHUR³0DG´$QWKRQ\:D\QHWR :HHQFRXUDJHRXUVWXGHQWVWREHRIVHUYLFHWRWKHLUIHOORZ GHI\WKHZDUULQJ,QGLDQVDQGHVWDEOLVK)RUW'H¿DQFH3HDFH VWXGHQWVWKHLUFKRVHQ¿HOGVRIVWXG\WKHLUFRPPXQLWLHVDQG HYHQWXDOO\FDPHWRWKHDUHDDQG)RUW'H¿DQFHEHFDPH'H¿DQFH WKHZRUOG:HSURYLGHRSSRUWXQLWLHVIRUVWXGHQWVWRWUDQVIRUP Ohio, in 1836. VRFLHW\WKURXJKFLYLFHQJDJHPHQWDORQJZLWKDSSOLFDWLRQRIWKHLU NQRZOHGJHDQGXQGHUVWDQGLQJWRVHUYLFH 'H¿DQFH&ROOHJHZDVIRXQGHGLQZKHQWKH2KLR/HJLVODWXUH VHWDVLGHDFUHDJHIRUWKHQHZO\LQFRUSRUDWHG'H¿DQFH)HPDOH Seminary. Land for the campus was not procured until 1875, Educational Philosophy ZKHQ'H¿DQFHUHVLGHQW:LOOLDP&+ROJDWHDFFHSWHGIRU 'H¿DQFH&ROOHJHHPSKDVL]HVOHDUQLQJEDVHGRQWKHIRXUSLOODUV QLQHDFUHVLQQRUWK'H¿DQFH7KH6HPLQDU\KHOGLWV¿UVWFODVVHV RILWVPLVVLRQ³WRNQRZWRXQGHUVWDQGWROHDGDQGWRVHUYH´ LQDQGGHVSLWHLWVQDPHJUDGXDWHGLWV¿UVWFODVVRIIRXUPHQ Within the tradition of liberal education, students experience DQG¿YHZRPHQLQ broadly based learning in communication skills, critical thinking, PRUDOGHYHORSPHQWWKHH[DPLQDWLRQRIJOREDOVRFLHWLHVDQGWKH ,Q WKHQDPHEHFDPH7KH'H¿DQFH&ROOHJH6KRUWO\ DELOLWLHVQHHGHGWRIXQFWLRQZLWKLQDGLYHUVHVRFLHW\6WXGLHV WKHUHDIWHUWKH&ROOHJHEHFDPHDI¿OLDWHGZLWKWKH&KULVWLDQ within the humanities, arts, sciences, and social sciences lead to Church which later became the United Church of Christ. The DQXQGHUVWDQGLQJRIWKHFRPSOH[GLYHUVHZRUOGLQZKLFKZHOLYH &ROOHJH¶V8&&DI¿OLDWLRQFRQWLQXHVWRGD\ Because superior learning is a natural outcome of learning with HQJDJHPHQWWKHFROOHJHVWULYHVWRHQVXUHWKDWWUDGLWLRQDOOLEHUDO Mission Statement and Purposes HGXFDWLRQLVDFWLYHO\FRQQHFWHGWRWKHUHDOZRUOG/HDUQLQJDW 'H¿DQFH&ROOHJHLVDQLQGHSHQGHQWFRHGXFDWLRQDOLQVWLWXWLRQ 'H¿DQFHLVFKDUDFWHUL]HGE\IRUJLQJLQWHOOHFWXDOFRQQHFWLRQV related to the United Church of Christ. Through personal caring DQGHQJDJHPHQWRIWKHPLQGZLWKWKHHQYLURQPHQWWKHVHOIZLWK DWWHQWLRQZLWKLQDQHFXPHQLFDO&KULVWLDQHQYLURQPHQWWKDW RWKHUVWKHLQGLYLGXDOZLWKFRPPXQLW\JHQHUDOLW\ZLWKFRQWH[W YDOXHVSHRSOHZLWKGLIIHUHQWEHOLHIVRXUFRPPXQLW\RIOHDUQHUV and deliberation with action. As a result, students are expected to LVGHGLFDWHGWRQXUWXULQJWKHZKROHSHUVRQWKURXJKGHYHORSPHQW FRPELQHNQRZOHGJHDQGXQGHUVWDQGLQJZLWKDFWLYHOHDGHUVKLSDQG of the intellectual, emotional, spiritual, social and physical VHUYLFHDVWKH\GHYHORSUHDVRQLQJDELOLWLHVVXSHULRUSURIHVVLRQDO dimensions of self. We seek to inspire within our students a VNLOOVDZHOOGHYHORSHGVHQVHRIVHOIDQGPRUDOMXGJPHQWDQGDQ VHDUFKIRUWUXWKDVHQVLWLYLW\WRRXUZRUOGDQGWKHGLYHUVHFXOWXUHV XQGHUVWDQGLQJRIWKHLUFLYLFUROHVDQGUHVSRQVLELOLWLHV within it, the ability to lead in their chosen professions, and a VSLULWRIVHUYLFH:HZDQWWKHPWRNQRZWRXQGHUVWDQGWROHDG 6XSHULRUOHDUQLQJLVUHDOL]HGWKURXJKDFWLYHHQJDJHPHQW DQGWRVHUYH LQXQGHUJUDGXDWHUHVHDUFKVHUYLFHOHDUQLQJDQGFDPSXV RUJDQL]DWLRQVDQGDFWLYLWLHV,WLVVKDUHGDQGH[SDQGHGWKURXJK TO KNOW interaction with like professionals and in leadership opportunities, :HEHOLHYHWKDWWKHOLEHUDODUWVIRUPDEURDGEDVLVIRUDOOOHDUQLQJ FRRSHUDWLYHHGXFDWLRQDQGLQWHUQVKLSVDQGSDUWQHUVKLSVZLWK :HDI¿UPWKDWDFDGHPLFH[FHOOHQFHGHPDQGVDFRPPLWWHGVHDUFK local, regional, national, and international organizations. The IRUWUXWKFRPSHWHQF\LQUHVHDUFKDQGRWKHUSUREOHPVROYLQJ 'H¿DQFH&ROOHJHHGXFDWLRQZLOOSURYLGHVWXGHQWVZLWKWKH methods, the ability to synthesize knowledge from many sources, NQRZOHGJHDQGH[SHULHQFHVQHFHVVDU\IRUWKHLPSURYHPHQWRIWKH and a capacity for self-directed learning. world of tomorrow. College Learning Outcomes General Information 6
1.'HYHORSHIIHFWLYHFRPPXQLFDWLRQDELOLWLHVLQFOXGLQJWKH cultures. abilities to write and speak clearly and cogently. F $UWLFXODWHDHVWKHWLFYDOXHVWKDWGHPRQVWUDWHNQRZOHGJH D 'HPRQVWUDWHVNLOOZLWKDQDO\VLVZKLOHXVLQJFRQYHQWLRQV RIDQGVHQVLWLYLW\WRWKHYDULRXVFXOWXUDOLVVXHVWKDW of academic speech. DIIHFWWKHYLVXDOOLWHUDU\DQGSHUIRUPLQJDUWV E 'HPRQVWUDWHVNLOOZLWKDQDO\VLVZKLOHXVLQJFRQYHQWLRQV of academic writing. 6. 'HYHORSDELOLWLHVWRXQGHUVWDQGDQGUHVSRQGWRERWK F 'HPRQVWUDWHHIIHFWLYHFRPPXQLFDWLRQVNLOOVE\ PXOWLFXOWXUDOYDULDWLRQZLWKLQRQH¶VRZQVRFLHW\DQGJOREDO FRPELQLQJPXOWLSOHVXEMHFWVLVVXHVDQGFRQWHQWEDVHG VRFLHWDOGLIIHUHQFHVDQGFRQÀLFWV frameworks and presenting them according to the D 'HVFULEHWKHUHODWLRQVKLSEHWZHHQLQGLYLGXDOVDQGWKHLU FRQYHQWLRQVRIDFDGHPLFGLVFRXUVH cultures using ideas of structure, function, process, and change. 2.'HYHORSSUREOHPVROYLQJDELOLWLHVLQFOXGLQJWKHSURFHVVLQJ E 'HPRQVWUDWHWKHDELOLW\WRFRPSDUHDQGFRQWUDVWD and application of knowledge in accordance with models of different society to one’s own using social science critical thinking and research. models. D $QDO\]HYDULRXVNLQGVRIHYLGHQFHDQGGUDZPHDQLQJIXO F 'HPRQVWUDWHWKHDELOLW\WRLGHQWLI\DVRFLHWDOQHHGDQGD FRQFOXVLRQVXVLQJREVHUYDWLRQLQIHUHQFHDQGVXPPDU\ FXOWXUDOFRQÀLFWDVDUHVXOWRIDQDO\VLVDQGVXJJHVW skills. DPHOLRUDWLRQVZKLFKDUHFXOWXUDOO\VHQVLWLYH E 6WXG\DQGFULWLTXHRSSRVLQJRUDOWHUQDWLYHWKHRULHV arguments, or theses. 7. 'HYHORSDIUDPHZRUNOLQNLQJWKHFRQFHSWVRIVHUYLFH F 'HVLJQDQGLPSOHPHQWGLVFLSOLQHUHODWHGRU leadership, and research through the experience of curricular LQWHUGLVFLSOLQDU\UHVHDUFKRURWKHUVWUDWHJLHVWRVROYH DQGFRFXUULFXODUDFWLYLWLHVFRQVLVWHQWZLWKDSUDFWLFDOOLEHUDODUWV SUREOHPVDQGHYDOXDWHDFFRUGLQJWRUHOHYDQWVWDQGDUGV education. D (QJDJHLQDVHUYLFHDFWLYLW\DQGUHÀHFWRQOHDGHUVKLS 3. 'HYHORSWKHDELOLW\WRIRUPXODWHYDOXHMXGJPHQWVWKDWDUH opportunities and connections between self and the grounded in reality, well-reasoned, ethically informed, and that community. JLYHGXHFRQVLGHUDWLRQWRWKHEHOLHIVDQGLQGLYLGXDOLW\RIRWKHUV E ,GHQWLI\WKHQXPHURXVYDOXHVDQGSULQFLSOHVWKDW D ,GHQWLI\YDULRXVFKRLFHVLQJLYHQVLWXDWLRQVDQG XQGHUSLQDVHUYLFHSURMHFWDQGHQJDJHLQUHÀHFWLRQRQ GHPRQVWUDWHNQRZOHGJHRIWKHEHOLHIVDQGYDOXHVWKDW WKHVSHFL¿FYDOXHVWKDWDUHFRQQHFWHGWROHDGHUVKLSDQG are foundational to those choices. engagement with campus and community. E $UWLFXODWHWKHPRUDOHWKLFDODQGRUUHOLJLRXV F 'HYHORSLPSOHPHQWDQGHYDOXDWHDQH[SHULHQFHWKDW LPSOLFDWLRQVDQGUDPL¿FDWLRQVRIYDULRXV LQWHJUDWHVVHUYLFHOHDGHUVKLSDQGUHVHDUFKZLWKWKH FKRLFHVLQ JLYHQVLWXDWLRQV JRDORIFRQWULEXWLQJD¿HOGRIVWXG\RUDGGUHVVLQJD F (YDOXDWHDOWHUQDWLYHPRUDODQGRUHWKLFDOFKRLFHVLQ community need. UHODWLRQWRRQH¶VRZQYDOXHMXGJPHQWPRGHODQGWKH YDOXHDQGHWKLFVRIRQH¶VGLVFLSOLQH 8. 6XFFHVVIXOO\FRPSOHWHDPDMRUSURJUDPRIVWXG\ D 3HUIRUPDWDOHYHOLQLQWURGXFWRU\OHDUQLQJDQG 4. 'HYHORSDPRGHUQVFLHQWL¿FSHUVSHFWLYHRIWKHQDWXUDOZRUOG GHYHORSPHQWWKDWGHPRQVWUDWHVDSUREDELOLW\RIVXFFHVV and society. LQWKHFKRVHQPDMRUSURJUDPRIVWXG\ D 'HPRQVWUDWHDQXQGHUVWDQGLQJRIWKHVFLHQWL¿FPHWKRG E 'HPRQVWUDWHVDWLVIDFWRU\SURJUHVVLQWKHGHYHORSPHQW DQGWKHVLJQL¿FDQFHRIGLYHUVLW\FKDQJHDQG of intermediate understanding, knowledge, and skills in adaptation in the biological world. WKHFKRVHQPDMRUSURJUDPRIVWXG\ E 'HPRQVWUDWHDVFLHQWL¿FDQGPDWKHPDWLFDO F 'HPRQVWUDWHWKHDFFRPSOLVKPHQWRIDQGWKHDELOLW\ XQGHUVWDQGLQJRIKRZWKHXQLYHUVHDQGLWVSK\VLFDO to apply and integrate all understanding, mechanisms work. NQRZOHGJHDQG VNLOOVLQWKHFKRVHQPDMRU F 'HPRQVWUDWHDQXQGHUVWDQGLQJRIWKHVFLHQWL¿FPHWKRG program of study. and its resulting knowledge of self, society, and human interactions.
5. 'HYHORSDQXQGHUVWDQGLQJRIWKHKLVWRU\LVVXHVYDOXHVDQG DHVWKHWLFVRIYDULRXVFXOWXUHVDQGIRUPXODWHLQIRUPHGUHVSRQVHV to them. D $QDO\]HJOREDOFXOWXUDOLVVXHVXVLQJPXOWLSOH frameworks of arts and humanities as well as the SHUVSHFWLYHGHYHORSHGRXWRIRQH¶VRZQFXOWXUDOYDOXHV E 'HPRQVWUDWHWKHDELOLW\WRDSSO\PXOWLSOHIUDPHZRUNVRI thought and aesthetics to the artifacts of two or more General Information 7
Assessment of Student Learning stewardship, utilization of and respect for the resources 'H¿DQFH&ROOHJHKDVGHYHORSHGDFRXUVHEDVHGSURFHVVIRUWKH RIWKHQDWXUDOZRUOGLQGLYLGXDOVDQGLQVWLWXWLRQV assessment of the eight institutional learning outcomes. Within VHUYLFHWRRWKHUVDVDQH[SUHVVLRQRIIDLWKDQGDZD\IRU FRXUVHVERWKJHQHUDOVWXGLHVDQGPDMRUYDULRXVRXWFRPHV OLIHHQULFKPHQWDQGIXO¿OOPHQW DUHLGHQWL¿HGIRUDVVHVVPHQW(DFKVWXGHQW VSHUIRUPDQFHRQ WKHHQFRXUDJHPHQWRIFULWLFDOHWKLFDOYDOXHIRUPDWLRQ WKHVHRXWFRPHVLVHYDOXDWHGDQGUHSRUWHGWREHFRPHSDUWRI FRQVLVWHQWZLWKRQH¶VIDLWK DQG an assessment database. This data is for institutional research DKROLVWLFYLHZRIOLIHZKLFKDWWDFKHVVLJQL¿FDQFHDQG RQO\WRDVVLVWLQWKHLPSURYHPHQWRILQVWUXFWLRQFXUULFXOXP worth to all honorable walks of life and human DQGUHVRXUFHDOORFDWLRQ'DWDRILQGLYLGXDOVWXGHQWVDUHQHYHU HQGHDYRUV GLYXOJHGKDYHQRHIIHFWRQJUDGLQJDQGDUHKHOGLQWKHVWULFWHVW FRQ¿GHQFH7RDVVLVWLQGRFXPHQWDWLRQRIWKHDVVHVVPHQW 'H¿DQFH&ROOHJHDVDFKXUFKUHODWHGLQVWLWXWLRQLVSULYLOHJHGWR process, examples of student work are collected and retained represent the Christian faith fairly and credibly in an ecumenical anonymously. DWPRVSKHUHZKLFKDOORZVLQGLYLGXDOVWRPDNHWKHLURZQFKRLFHV DQGFRPPLWPHQWV,QDSSURSULDWHFRXUVHVDQGFDPSXVDFWLYLWLHV $VVHVVPHQWRIVWXGHQWOHDUQLQJLQWKHPDMRUSURJUDPVDVVLVWVLQ by staff and student example, and by planned and spontaneous WKHLPSURYPHQWRILQVWUXFWLRQHIIHFWLYHDGYLVHPHQWDQGFDUHHU HQFRXQWHU&KULVWLDQLW\LVSUHVHQWHGDVDYLDEOHIDLWK'H¿DQFH GHYHORSPHQW &ROOHJHVHHNVWRIXO¿OOLWVPLVVLRQLQVLGHDQGRXWVLGHWKH classroom in ways which integrate the mental, physical, social and spiritual dimensions of human life. Accreditation 'H¿DQFH&ROOHJHLVDFFUHGLWHGE\WKH&RPPLVVLRQRQ,QVWLWXWLRQV of Higher Education of the North Central Association of Non-Discrimination Statement Colleges and Schools, 30 N. LaSalle Street, Suite 2400, Chicago, ,QLWVSURJUDPVDFWLYLWLHVDQGSROLFLHV'H¿DQFH&ROOHJHGRHV ,OOLQRLV ,WLVDSSURYHGE\WKH QRWHQJDJHLQLOOHJDOGLVFULPLQDWLRQDJDLQVWVWXGHQWVSURVSHFWLYH Ohio Department of Education for the training of professional VWXGHQWVHPSOR\HHVRUSURVSHFWLYHHPSOR\HHVEHFDXVHRI educators. The social work program is accredited by the Council race, color, creed, gender, national or ethnic origin, sexual on Social Work Education. The business and information orientation or disability. Any inquiries regarding the College’s technology programs are initially accredited by the International QRQGLVFULPLQDWRU\SROLFLHVVKRXOGEHGLUHFWHGWRWKH$I¿UPDWLYH Assembly for Collegiate Business Education. $FWLRQ2I¿FHU'H¿DQFH&ROOHJHLVDXWKRUL]HGXQGHUIHGHUDOODZ WRHQUROOQRQLPPLJUDQWDOLHQVWXGHQWV'H¿DQFH&ROOHJHDGPLWV students regardless of race, color, creed, sex, national or ethnic 8&&$I¿OLDWLRQ origin, sexual orientation or disability. 3URXGRILWVKHULWDJH'H¿DQFH&ROOHJHIUHHO\PDLQWDLQVLWV FRYHQDQWDOVWDWXVDVD8QLWHG&KXUFKRI&KULVWUHODWHGFROOHJH independent of church control. Student Complaint Policy 'H¿DQFH&ROOHJHLVUHTXLUHGE\1RUWK&HQWUDO$VVRFLDWLRQRI The United Church of Christ supports colleges as part of its Colleges and Schools to maintain a record of written student PLVVLRQWRDQGVHUYLFHIRUVRFLHW\ZLWKWKHJRDORIQXUWXULQJPHQ FRPSODLQWV¿OHGZLWKWKHRI¿FHRIWKH3UHVLGHQWWKH$FDGHPLF and women toward wholeness in competence and conscience. Dean, and the Dean of Students. Such complaints must be 7KHWKHRORJ\RIWKH8QLWHG&KXUFKRI&KULVWDI¿UPHGE\ ZULWWHQDQGVLJQHGE\DVWXGHQWRI'H¿DQFH&ROOHJH7KHUHFRUG 'H¿DQFH&ROOHJHLQFOXGHV will include information on the resolution of the complaint. Though the College is required to share this record with North DEHOLHILQWKH*RGJLYHQGLJQLW\DQGZRUWKRIHDFK SHUVRQDQGDGHHSFRQFHUQIRUWKHGHYHORSPHQWRIZKROH Central Association, the anonymity of the complainant and SHUVRQV others mentioned in the complaint is protected unless a release is a recognition of the importance of interpersonal signed by the complainant. Further information on this policy is relationships and the fostering of growth in a caring DYDLODEOHIURPWKH$FDGHPLF'HDQ V2I¿FH FRPPXQLW\ DVWURQJDGYRFDF\IRURSHQLQWHOOHFWXDOLQTXLU\DQG Admission DFDGHPLFIUHHGRP 7KH'H¿DQFH&ROOHJHVHOHFWVFDQGLGDWHVIRUDGPLVVLRQIURPWKRVH DWUXVWWKDWWKHWUXWKVRQHGLVFRYHUVLQWKHGLYHUVH¿HOGV RILQTXLU\DUHXOWLPDWHO\LQWHUUHODWHG DSRVLWLYHHFXPHQLFDORXWORRNPRYLQJEH\RQGWROHUDQFH and acceptance to understanding and appreciation of ERWKUHOLJLRXVDQGFXOWXUDOGLYHUVLW\ DUHFRJQLWLRQRIWKHSULYLOHJHDQGUHVSRQVLELOLW\RI Admission 8
ZKRHYLGHQFHDFDGHPLFDFKLHYHPHQWDSWLWXGHDQGWKHDELOLW\ $FRPSOHWHG'H¿DQFH&ROOHJHapplication for WREHQH¿WIURPDQGFRQWULEXWHWRWKHRSSRUWXQLWLHVRIIHUHGDWWKH admission. College. $QRQUHIXQGDEOHDSSOLFDWLRQIHH7KH DSSOLFDWLRQIHHLVZDLYHGIRURQHRIWKHIROORZLQJ DQ LQGLYLGXDOFDPSXVYLVLWRUJURXSYLVLWDWLRQGD\ Campus Visit VHQLRUV DQGWUDQVIHUVRQO\ DSSO\LQJRQOLQH 3URVSHFWLYHVWXGHQWVDQGWKHLUIDPLOLHVDUHVWURQJO\HQFRXUDJHG RUD&ROOHJH%RDUG :DLYHU)RUP$ WRYLVLW7KLVSURYLGHVDQRSSRUWXQLW\WRH[SORUHRXUFDPSXVDQG OHWWHUUHTXHVWLQJDZDLYHUIURPDKLJK PHHWWKHSHRSOHWKDWPDNH'H¿DQFH&ROOHJHXQLTXH7KH2I¿FH VFKRROJXLGDQFHFRXQVHORUZLOOEHUHYLHZHGE\WKH RI$GPLVVLRQRIIHUVDYDULHW\RIVFKHGXOHG&DPSXV9LVLWDWLRQ Director of Admissions. 'D\VRUZLOOGHVLJQDQLQGLYLGXDOYLVLWEDVHGRQWKHQHHGVDQG 3. 2I¿FLDOH[DPLQDWLRQVFRUHV from the ACT Assessment LQWHUHVWVRIWKHSURVSHFWLYHVWXGHQW $&7 RUWKH6FKRODVWLF$VVHVVPHQW7HVWRIWKH&ROOHJH ([DPLQDWLRQ%RDUG 6$7 DUHUHTXLUHGRIDOODSSOLFDQWV - ,QGLYLGXDORUJURXSYLVLWVPD\EHVFKHGXOHGE\FRQWDFWLQJWKH2I WR WKHIUHVKPDQFODVV,I¿YHRUPRUH\HDUVKDYH ¿FHRI$GPLVVLRQDW*2'&RU ZHHN- passed since high school days from 8:00 a.m. to 4:30 p.m., and most Saturdays 9:00 a.m. graduation, this requirement may not be WR SPIURP6HSWHPEHUWKURXJK0D\7KHRI¿FHPD\DOVR applicable. EHUHDFKHGE\HPDLODW DGPLVVLRQV#GH¿DQFHHGXRUE\ID[DW 419-783-2468. Directions to the campus, hotel and restaurant Information regarding registration, test dates, and LQIRUPDWLRQDORQJZLWKVLWHVRIORFDOLQWHUHVWDUHDYDLODEOHRQWKH location may be obtained from a high school guidance 'H¿DQFH&ROOHJHZHEVLWHRUXSRQUHTXHVW FRXQVHORUWKH'H¿DQFH&ROOHJH$GPLVVLRQ2I¿FHRU from: American College Testing Program, 2201 How To Apply N. Dodge Street, PO Box 451, Iowa To obtain application materials and information, contact the City, IA 52243 or www.act.org. Also from: 2I¿FHRI$GPLVVLRQE\SKRQH*2'&RU College Board, PO Box 6200, Princeton, NJ 08541 or www.collegeboard.com. HPDLODGPLVVLRQV#GH¿DQFHHGX RUID[ Completed materials may be mailed to: 'H¿DQFH&ROOHJH¶V$&7FROOHJHFRGHQXPEHU3264, VKRXOGEHSODFHGRQWKHH[DPLQDWLRQIRUWKHRI¿FLDO 'H¿DQFH&ROOHJH reporting of the scores. The SAT college code number is 2I¿FHRI$GPLVVLRQV 1162. 701 N. Clinton Street 4. $QRI¿FLDOKLJKVFKRROWUDQVFULSW sent directly from the 'H¿DQFH2KLR school or test scores from the General Educational 'HYHORSPHQW7HVW *(' 3URVSHFWLYHVWXGHQWVPD\DOVRDSSO\RQOLQHDWWKHDGPLVVLRQVHF- 5. $QRI¿FLDOWUDQVFULSWIURPHDFKFROOHJHDQGXQLYHUVLW\ WLRQRI'H¿DQFH&ROOHJH¶VZHEVLWHDWZZZGH¿DQFHHGX. attended sent directly from the institution to the 'H¿DQFH &ROOHJH$GPLVVLRQV2I¿FH $UHFRPPHQGDWLRQE\DKLJKVFKRROWHDFKHU RIDQ When To Apply DFDGHPLFVXEMHFW (QJOLVKVRFLDOVFLHQFHPDWKRU 'H¿DQFH&ROOHJHKDVDUROOLQJDGPLVVLRQSROLF\ LWDFFHSWVDSSOL- IRUHLJQODQJXDJH SULQFLSDORUJXLGDQFHFRXQVHORURUD cations for admission throughout the calendar year. Candidates SHUVRQDOLQWHUYLHZ may be required of some students. are urged to submit an application at least one month prior to the +RPHVFKRROHGVWXGHQWVDUHH[SHFWHGWRKDYH expected date of enrollment although students are encouraged completed the college preparatory units listed in the to apply for admission at the earliest possible date. An early ap- admissions criteria section below. SOLFDWLRQSURYLGHVRSWLPDORSSRUWXQLW\IRU¿QDQFLDODLGDZDUGV 8. Candidates to the freshman class who completed any course selection, and campus housing. High school students are portion of their secondary education through home encouraged to apply in the fall of their senior year and may apply VFKRROLQJDUHUHTXLUHGWRFRPSOHWHWKH'H¿DQFH DWWKHFRPSOHWLRQRIWKHMXQLRU\HDU$SSOLFDWLRQVDUHDFFHSWHG College Home Schooled Information Form for the fall, spring or summer sessions. DYDLODEOHIURPWKH $GPLVVLRQV 2I¿FH+RPHVFKRROHGVWXGHQWV are Admission Requirements H[SHFWHGWRKDYHFRPSOHWHGWKHFROOHJH The following are required to complete the application process: preparatory units listed in the admissions criteria section below. Admission 9
Post Secondary Enrollment Options International Student Admission (Dual Enrollment Options) The following are required to complete the application process: 'H¿DQFH&ROOHJHSDUWLFLSDWHVLQWKH2KLR3RVW6HFRQGDU\(QUROO- International Student $FRPSOHWHG'H¿DQFH&ROOHJH ment Option — Dual Enrollment program. Interested students application for admission. VKRXOG¿UVWFRQWDFWWKHLUKLJKVFKRROJXLGDQFHFRXQVHORUIRU 2. A $25 non-refundable application fee. LQIRUPDWLRQRQWKLVSURJUDP$GGLWLRQDOLQIRUPDWLRQLVDYDLODEOH 3. $QRI¿FLDOWUDQVFULSWRIDOOVHFRQGDU\DQGSRVW IURPWKH2I¿FHRI$GPLVVLRQ VHFRQGDU\JUDGHVDQGFRXUVHZRUN. If these transcripts DUHQRWLQ(QJOLVKDWUDQVODWLRQPXVWEHSURYLGHG 4. $QRI¿FLDO VFRUHUHSRUWRIWKH7HVWRI(QJOLVKDVD Admission Criteria Foreign Language 72()/ ,QIRUPDWLRQRQWKLVWHVW To be considered for full admission in good standing, applicants can be obtained at the following website: PXVWVXSSO\HYLGHQFHRIOLNHO\VXFFHVVDVD'H¿DQFH&ROOHJH ZZZWRHÀRUJRUDW72()/6HUYLFHV32%R[ student including: 6151, Princeton, NJ USA 08541. 5. 2I¿FLDOH[DPLQDWLRQVFRUHV from the ACT Assessment )RUDSSOLFDQWVWRWKHIUHVKPDQFODVV $&7 RUWKH6FKRODVWLF$VVHVVPHQW7HVWRIWKH&ROOHJH $KLJKVFKRROGLSORPD*('FHUWL¿FDWHRUHTXLYDOHQW ([DPLQDWLRQ%RDUG 6$7 2. A secondary school academic record indicating a 6. (YLGHQFHRIDGHTXDWHPHDQVRI¿QDQFLDOVXSSRUW by PLQLPXPRI DFXPXODWLYHJUDGHSRLQWDYHUDJH VXEPLVVLRQRIDQRULJLQDORUFHUWL¿HGFRS\RIWKH VFDOH DQGDQ$&7FRPSRVLWHVFRUHRI 'RFXPHQWDWLRQRI)LQDQFLDO5HVRXUFHV LQFOXGHGLQWKH 18 or an SAT combined score of 'H¿DQFH&ROOHJH,QWHUQDWLRQDO6WXGHQW$SSOLFDWLRQ 850. )RUP ,WLVUHFRPPHQGHGWKDWVWXGHQWVKDYHWDNHQDFROOHJHSUHSD- Additional information may be obtained at the Immigration and ratory curriculum including: 1DWXUDOL]DWLRQ6HUYLFH¶VZHEVLWH ZZZLQVJRYRUE\FDOOLQJWKH English —four units ,166HUYLFH&HQWHUDW Mathematics — three units Science — three units Social Studies — two units Student Re-Enrollment Foreign Language — two units of the same language )RUPHU'H¿DQFH&ROOHJHVWXGHQWVZKRKDYHZLWKGUDZQIURPWKH Visual and/or Performing Arts — one unit &ROOHJHRUKDYHIDLOHGWRPDLQWDLQFRQWLQXRXVHQUROOPHQWPD\ apply for re-enrollment. For transfer students: $KLJKVFKRROGLSORPD*('FHUWL¿FDWHRUHTXLYDOHQW The following are required to complete the application for re- $QRI¿FLDOWUDQVFULSWIURPHDFKFROOHJHRUXQLYHUVLW\ enrollment process: DWWHQGHG DSSOLFDQWVPXVWKDYHDPLQLPXPRID 1. A completed application for re-enrollment DYDLODEOH FXPXODWLYHJUDGHSRLQWDYHUDJH VFDOH IURPWKHODVW IURPWKH5HJLVWUDWLRQ&HQWHU college attended. 2. $QRI¿FLDOWUDQVFULSWIURPHDFKFROOHJHDQGXQLYHUVLW\ 3. A record indicating good standing socially from each attended in the interim sent directly from the institution FROOHJHRUXQLYHUVLW\DWWHQGHG WRWKH5HJLVWUDUDW'H¿DQFH&ROOHJH $VXVSHQVLRQGLVPLVVDOIRUPFRPSOHWHGE\WKHSUHYLRXV For international students: college, if the student was suspended or dismissed. ,QDGGLWLRQWRWKHFULWHULDOLVWHGDERYHLQWHUQDWLRQDOVWXGHQWV must: 'HPRQVWUDWH(QJOLVKODQJXDJHSUR¿FLHQF\GHPRQVWUDWHG Transient Student Admission by a minimum score of 550 on the Test of English as a Students who are enrolled in another institution and wish to take )RUHLJQ/DQJXDJH 72()/ DFRXUVHIURP'H¿DQFH&ROOHJHDUHUHTXLUHGWR
1. A completed transient student application form DYDLODEOHIURPWKH5HJLVWUDWLRQ&HQWHU Admission Decision 2. $VWDWHPHQWRIDSSURYDOIURPWKHVWXGHQW¶VKRPH (DFKFDQGLGDWHIRUDGPLVVLRQLVUHYLHZHGLQGLYLGXDOO\ZLWKFDUH- institution. IXOFRQVLGHUDWLRQJLYHQWRDFDGHPLFUHFRUGVWHVWVFRUHVDXWRELR- 3. A $20 non-refundable transient student JUDSKLFDOVWDWHPHQWVUHFRPPHQGDWLRQVDQGWKHDELOLW\WREHQH¿W registration fee. from and contribute to the opportunities offered at the College. Admission 10
'H¿DQFH&ROOHJHGRHVQRWHQJDJHLQLOOHJDOGLVFULPLQDWLRQ DJDLQVWSURVSHFWLYHVWXGHQWVEHFDXVHRIUDFHFRORUFUHHGJHQGHU QDWLRQDODQGHWKQLFRULJLQRUGLVDELOLW\7KH'H¿DQFH&ROOHJH UHVHUYHVWKHULJKWWRGHQ\DGPLVVLRQWRDQ\DSSOLFDQWLQWKHEHVW interest of the student or the institution.
When a candidate has completed the application process, one of the following decisions will be made: 1. Full Admission in Good Standing 2. Admission on Academic Probation 7KH$GPLVVLRQ5HYLHZ&RPPLWWHHHYDOXDWHVDOOWUDQVIHU applicants who fail to meet the minimum admission FULWHULDDQGWKRVHMXGJHGE\WKH'LUHFWRURI$GPLVVLRQ WR ZDUUDQWUHYLHZ$OLPLWHGQXPEHURIWUDQVIHU students who demonstrate ability and PRWLYDWLRQWRDFKLHYH DFDGHPLF success are granted full admission on academic probation and are expected to earn a 2.00 or KLJKHUJUDGHSRLQWDYHUDJHLQWKH¿UVWVHPHVWHURI enrollment. 3. Conditional Admission 7KH$GPLVVLRQ5HYLHZ&RPPLWWHHHYDOXDWHVDOO candidates to the freshman class who fail to meet the PLQLPXPDGPLVVLRQFULWHULDDQGWKRVHMXGJHGE\WKH 'LUHFWRURI$GPLVVLRQWRZDUUDQWUHYLHZ$OLPLWHG number of students who demonstrate ability and PRWLYDWLRQWRDFKLHYHDFDGHPLFVXFFHVVDUHJUDQWHG conditional admission. Students under conditional VWDWXVZLOOEHUHTXLUHGWRSDUWLFLSDWHLQSURYLVLRQV WRSURPRWHDFDGHPLFDFKLHYHPHQWDVHVWDEOLVKHGE\WKH )DFXOW\DQGUHFRPPHQGHGE\WKH$GPLVVLRQ5HYLHZ &RPPLWWHH7KHVHSURYLVLRQVPD\LQFOXGHDUHGXFWLRQLQ FRXUVHORDGDVZHOODVHQUROOPHQWLQVSHFL¿FFODVVHVDQG support programs. 4. 3URYLVLRQDO$GPLVVLRQ ,QVRPHFDVHVVWXGHQWVZLOOEHJLYHQSURYLVLRQDODGPLVVLRQ EDVHGRQVHOIUHSRUWHGLQIRUPDWLRQRUXQRI¿FLDOGRFXPHQWV SHQGLQJUHFHLSWRIRI¿FLDOGRFXPHQWDWLRQWRFRPSOHWHWKHLU DSSOLFDWLRQ¿OH,IRI¿FLDOGRFXPHQWDWLRQDUULYHVLQWKH time period allowed, and is consistent with prior information, the student will be granted full admission in good standing or conditional admis- sion. 5. Denied Admission 7KH$GPLVVLRQ5HYLHZ&RPPLWWHHGHWHUPLQHVGHQLDORI DGPLVVLRQWR'H¿DQFH&ROOHJH$QDSSOLFDQWGHQLHG admission has the right to appeal such a decision in writing WRWKH9LFH3UHVLGHQWIRU$FDGHPLF$IIDLUVSURYLGHGWKH DSSOLFDQWFDQSUHVHQWUHOHYDQWDGGLWLRQDOLQIRUPDWLRQ LQGLFDWLQJDELOLW\DQGPRWLYDWLRQWRDFKLHYHDFDGHPLF success.
Tuition Deposit $WXLWLRQGHSRVLWRILVUHTXLUHGRIDOOIXOOWLPHVWXGHQWV Costs 11
Tuition, Room and Board per credit hour 'H¿DQFH&ROOHJHUHVHUYHVWKHULJKWWRFKDQJHWXLWLRQDQGIHHV rates for room and board, or any other charges when necessary 2YHUORDG H[FHVVRIFUHGLWVSHUVHPHVWHU SHUFUHGLWKRXU because of economic or other conditions. Announcement of such changes will normally be made before the beginning of the *UDGXDWH7XLWLRQ SHUFUHGLWKRXU VFKRRO\HDURUWHUPLQZKLFKDUDWHFKDQJHEHFRPHVHIIHFWLYH /DWH5HJLVWUDWLRQ)HH $QRQUHIXQGDEOHIHHPD\EH $Q\FXUUHQWO\HQUROOHG'H¿DQFH&ROOHJHVWXGHQWPD\YLHZ assessed to students who do not complete the registration his/her current term billing statement and other records on-line by SD\PHQWSURFHVVE\WKHSD\PHQWGXHGDWHVRI$XJXVW )DOO DQG accessing KWWSV ZZZGH¿DQFHHGXRQHVWRS. The web interface 'HFHPEHU 6SULQJ may be accessed from any computer with access to the Internet and the proper browser software. Logon requires the student’s Schedule of Fees, 2004-2005 Health Insurance Fee: Health insurance is required for all full- &RPSUHKHQVLYH7XLWLRQSHUVHPHVWHU WLPHVWXGHQWVDQGRSWLRQDOIRUVWXGHQWVHQUROOHGIRUVL[WRHOHYHQ FUHGLWVSHUVHPHVWHU credit hours. Cost estimates for the 2004-2005 academic year Room: (per semester) DUHOLVWHGEHORZ7KHIHHLVZDLYHGXSRQSURRIRIRWKHULQVXUDQFH 0F5H\QROGV:KLWQH\+DOO'RXEOH5RRP FRYHUDJH $SDUWPHQW'RXEOH5RRP Annual Spring/Summer 6WXGHQW Meal Plan (If a resident student, meal plan is required) 6SRXVH PHDOV6HPHVWHU)OH[6SHQGLQJ (DFK&KLOG PHDOV6HPHVWHU)OH[6SHQGLQJ PHDOV6HPHVWHU)OH[6SHQGLQJ 5RRPDQG0HDO3ODQ&KDQJH)HH $QRQUHIXQGDEOHIHHPD\ 75 Block Meal Plan - seniors in apartment be assessed for a drop or change of room or meal plan. A change in the room and/or meal plan will not be accepted after July 1 5HVLGHQW)UHVKPHQDUHUHTXLUHGWRSDUWLFLSDWHLQWKH 0HDO )DOO DQG1RYHPEHU 6SULQJ 7KH'HDQRI6WXGHQW/LIHPXVW 3ODQRSWLRQ$WKOHWHVDUHUHTXLUHGWRSDUWLFLSDWHLQWKH RU DSSURYHWKHFDQFHOODWLRQRIURRPDQGPHDOSODQ 0HDO3ODQRSWLRQ :LWKGUDZDO3URFHVVLQJ)HH $IHHIRUSDUWWLPHVWXGHQWV FUHGLWKRXUV DQGDIHHIRUIXOOWLPHVWXGHQWVZKRDUH Other Fees and Charges withdrawing from college. 6WXGHQW)HH $QRQUHIXQGDEOHVWXGHQWIHHLVFKDUJHGWRIXOO time students each semester of enrollment. This fee is distributed 7UDQVFULSWV $QRI¿FLDOFRS\RIDVWXGHQW¶VUHFRUGZLWKWKH WRVXSSRUWVWXGHQWDFWLYLWLHVDQGVWXGHQWRUJDQL]DWLRQV &ROOHJHVHDODQG5HJLVWUDU¶VVLJQDWXUH$QXQRI¿FLDOFRS\RID FXUUHQWVWXGHQW VWUDQVFULSWFDQEHDFHVVHGE\YLVLWLQJWKH&ROOHJH $QRQUHIXQGDEOHVWXGHQWIHHLVFKDUJHGWRSDUWWLPH website at KWWSV ZZZGH¿DQFHHGXRQHVWRS. A transcript undergraduate students each semester of enrollment. This fee may be denied if a student needs to complete student loan exit LVGLVWULEXWHGWRVXSSRUWVWXGHQWDFWLYLWLHVRUJDQL]DWLRQVDQG FRXQVHOLQJSD\DOLEUDU\¿QHRUSD\WKHEDODQFHRQKLVKHU technology on campus. student account or any other charges outstanding. 7HFKQRORJ\)HH $QRQUHIXQGDEOHIHHLVFKDUJHGWRDOO $GPLVVLRQ$SSOLFDWLRQ)HH full-time students, under-graduate and graduate, each semester. 3DUWWLPHJUDGXDWHVWXGHQWVDUHFKDUJHGHDFKVHPHVWHU$OO 6WXGHQWWHDFKLQJIHH QRQUHIXQGDEOH undergraduate and graduate students enrolling in a summer term DUHFKDUJHGDIHH7KHVHIHHVDUHXVHGWRLPSURYHDOOFDPSXV 6HQLRUFLWL]HQVWXLWLRQ 3HUFRXUVH$Q\SHUVRQZKRKDV technology. reached 60 year of age may enroll in an undergraduate course for this reduced fee. Senior citizens may enroll in graduate courses Residential Fee: Resident students are assessed a onetime non- but will be charged the usual graduate tuition rate. Audits of UHIXQGDEOHIHHRI2WKHUIHHVPD\EHFKDUJHGIRUNH\DQG graduate courses are not allowed. card replacement, improper check-out, and room damage. Auditing courses: Any student may audit a course. Auditing 3DUWWLPH8QGHUJUDGXDWHDQG:HHNHQG&ROOHJH7XLWLRQ IHHLVSHUFUHGLWKRXU:KHQFODVVVL]HLVOLPLWHGIXOOIHH Financial Policies 12 VWXGHQWVKDYHSULRULW\0XVLFSULYDWHLQVWUXFWLRQFDQQRWEH included and deferral is not allowed for books, fees, or other audited. supplies. The option is limited to students in good academic and ¿QDQFLDOVWDQGLQJDVGH¿QHGE\WKHFROOHJH¶VXQGHUJUDGXDWHDQG 0XVLFFKDUJHV 7XLWLRQIRUDSSOLHGPXVLFLQVWUXFWLRQLVSHU graduate catalogs. Details and procedures for this deferral option FUHGLWKRXU RQHKDOIKRXUSULYDWHOHVVRQSHUZHHN DUHDYDLODEOHIURPWKH5HJLVWUDWLRQ&HQWHU International Student Admission Schedule of Payments International students must pay, in full, tuition and room and To recapitulate the information in the two preceding sections, ERDUGE\WKHSD\PHQWGXHGDWHV $XJXVWIRUIDOODQG'HFHPEHU fees for regular, full-time students should be paid according to the IRUVSULQJ following schedule: Prepayment of Tuition Prepayment of Tuition: A new student accepted for September admission is required to 'XH0D\IRUQHZVWXGHQWV PDNHDSUHSD\PHQWRIWRZDUGWXLWLRQ$IXOOUHIXQGZLOOEH 'XH-XQHIRUUHWXUQLQJVWXGHQWV made to a student who cancels his/her application before May 1 for fall enrollment. Fall semester charges are due August 1. During the second semester, currently-enrolled students schedule Spring semester charges are due December 1. IRUWKHQH[W\HDU7RFRQ¿UPWKHVFKHGXOLQJDUHWXUQLQJ VWXGHQWLVUHTXLUHGWRPDNHDWXLWLRQSUHSD\PHQWRIE\ Financial Status June 15. Failure to make the prepayment on time may preclude 7REHFRQVLGHUHGLQJRRG¿QDQFLDOVWDQGLQJVWXGHQWVPXVW registration in the fall and may delete the scheduling. FRPSOHWH¿QDQFLDODUUDQJHPHQWVRQRUEHIRUHRSHQUHJLVWUDWLRQ day. Failure to do so may deny the student the right to attend Payment of Accounts classes. Registrations are accepted only for a full semester, term, or other FOHDUO\GH¿QHGSHULRG%LOOVDUHGXHDQGSD\DEOHLQIXOORQRU 7RFRQWLQXHLQJRRG¿QDQFLDOVWDQGLQJVWXGHQWVPXVW before August 1 for Fall and December 1 for Spring. All charges FRPSOHWHDOOUHTXLUHG¿QDQFLDODLGSURFHGXUHVPHHWDOOGHIHUUHG for summer school must be paid on the day of registration. payment deadlines, and make other arrangements for any student Students not completing the registration payment process by the loans which might be denied. Failure to do so will result in the due dates may be assessed late fees. A signed bill, payment and account being delinquent and may result in one or more of the following actions: transcripts of student records will not be UHTXLUHG¿QDQFLDODLGGRFXPHQWVLIDSSOLFDEOHDUHVXEPLWWHG to the Registration Center by the due dates. Grade report card, released, diplomas of graduating seniors will be held, diploma, and/or transcripts may be withheld for any unpaid credit for courses currently being taken will be denied, balance. ERDUGZLOOEHGHQLHGYDFDWLQJFDPSXVKRXVLQJZLOOEHUHTXLUHG and the student may be withdrawn from the College. Deferred Payments Non-current accounts may be referred to outside collection 3HUVRQVZKR¿QGLWLQFRQYHQLHQWWRPDNHOXPSVXPSD\PHQWV agencies. Collection agency costs, along with penalties and at the beginning of each semester may make deferred payment interest incurred to collect accounts, may be added to the balance arrangements through the DC Monthly Payment Plan. DC due from the student. students and/or their parents may choose to pay their college expenses through eight monthly installments for the year. There LVDQDQQXDOQRQUHIXQGDEOHSDUWLFLSDWLRQIHH3D\PHQWVDUH Refund Policy GXHE\WKH¿UVWRIHDFKPRQWK,I\RXUSD\PHQWLVQRWUHFHLYHG )RUQHZVWXGHQWVWKHWXLWLRQGHSRVLWZKLFKLVGXHE\0D\ E\WKHGXHGDWHDSHUPRQWKODWHIHHZLOOEHDVVHVVHG,W IRU6HSWHPEHUHQUROOPHQWDQG1RYHPEHUIRUPLG\HDU is your responsibility to inform the Registration Center of any enrollment is fully refundable if such refund is requested before DGMXVWPHQWVWR\RXUDFFRXQWWKDWZRXOGDOWHU\RXUSD\PHQWV 0D\IRUWKH6HSWHPEHUHQUROOPHQWDQGEHIRUH1RYHPEHUIRU Students cannot pay the following through the Plan: Library the mid-year enrollment. ¿QHVERRNVWRUHFKDUJHVWHOHSKRQHFKDUJHVRUPLVFHOODQHRXV For students who fail to register for the period of enrollment for FKDUJHV,WLVWKHVWXGHQWV UHVSRQVLELOLW\WRNQRZWKHSD\PHQW due dates and to make the payments on time. ZKLFKWKH\ZHUHFKDUJHGZLWKGUDZGURSRXWWDNHDQXQDSSURYHG OHDYHRIDEVHQFHIDLOWRUHWXUQIURPDQDSSURYHGOHDYHRI Students whose employer has a tuition support plan may qualify absence, are expelled, or otherwise fail to complete the period of enrollment for which they were charged, the refund is calculated IRUGHIHUUHGSD\PHQW2QO\HPSOR\HUDSSURYHGFRXUVHVDUH Financial Policies 13 using the Federal Refund and Repayment method. All colleges $FWLYLW\)HH participating in the Federal Student Aid Programs are required to Course related fees use the Federal Refund and Repayment Calculation to determine Deferred payment plan fees WKHDPRXQWRIUHIXQG:KHQZLWKGUDZDOLVLQYROXQWDU\IRU Finance charges disciplinary reasons, the full institutional charges will be applied /DWHIHHV SD\PHQWSODQRUUHJLVWUDWLRQ after the federal refund calculation. Returned check fees 5HVLGHQFHIHHRUGDPDJHVRU¿QHV The Federal Refund and Repayment Calculations are described Technology Fee below. Student health insurance Withdrawal fee Refund Policy for Withdrawal from the College 2004-2005 All other institutional fees By registering for classes or completing a housing or meal plan application, a student incurs a legal obligation to pay tuition, fees, 8QRI¿FLDO:LWKGUDZDO room, and board. ,QWKHFDVHRIDQXQRI¿FLDOZLWKGUDZDORUDQXQDSSURYHGOHDYHRI DEVHQFH RUDVWXGHQW¶VIDLOXUHWRUHWXUQDWWKHHQGRIDQDSSURYHG 7REHJLQWKHZLWKGUDZDOSURFHVVWKHVWXGHQWPXVWJRWRWKH2I¿FH OHDYHRIDEVHQFH WKHZLWKGUDZDOGDWHLVWKHODVWUHFRUGHGGDWHRI RI6WXGHQW/LIHRU5HJLVWUDWLRQ&HQWHUWRREWDLQDQRI¿FLDOZLWK- FODVVDWWHQGDQFH DVGRFXPHQWHGE\WKH&ROOHJH drawal application. If a student withdraws prior to the start of the semester and incurs no charges, the tuition deposit is forfeited. /HDYHRI$EVHQFH If the student has incurred any charges, the deposit is applied to $VWXGHQWPD\EHJUDQWHGDQDSSURYHGOHDYHRIDEVHQFHLI those charges. If a student withdraws during the semester, charges WKHVWXGHQWKDVPDGHDZULWWHQUHTXHVWIRUWKHOHDYHRIDEVHQFH will be based on the percentage of days enrolled up to 60% of the WKHOHDYHRIDEVHQFHGRHVQRWH[FHHGGD\VWKH&ROOHJHKDV term or when the student began the withdrawal process. Room JUDQWHGRQO\RQHOHDYHRIDEVHQFHWRWKHVWXGHQWLQDQ\PRQWK is prorated and the meal plan is prorated plus one-week based on SHULRGDQGDSSURYDOLVUHFHLYHGIURPLQVWUXFWRUVDQGWKH$FD- WKHRI¿FLDOGDWHRIZLWKGUDZDOIURPFDPSXVKRXVLQJ demic Dean. 7KHVWXGHQWPD\DOVREHUHVSRQVLEOHIRUDQ\OLEUDU\¿QHVDQGRU Failure to return will result in a full withdrawal and refund ac- URRPGDPDJH¿QHV7KHUHLVDZLWKGUDZDOIHHDVVHVVHGIRUZLWK- cording to the last date of attendance. GUDZLQJDWDQ\WLPHIURPWKHLQVWLWXWLRQ3DUWWLPHVWXGHQWV FUHGLWKRXUV DUHDVVHVVHGDQG)XOOWLPHVWXGHQWVDUHDVVHVVHG &KDQJHRI5HVLGHQWLDO6WDWXV Students who change their housing status after the school year EHJLQVZLOOKDYHLQVWLWXWLRQDODLGDGMXVWHGDFFRUGLQJO\6WXGHQWV If a student has been enrolled for more than 60% of the term, s/he ZLOOEHDVVHVVHGDKRXVLQJFKDQJHIHHRIDQGPHDOSODQ is not eligible for a reduction in tuition, fees or housing charges. FKDQJHIHHRI7KHKRXVLQJIHHLVDSSOLHGWRFKDQJHVPDGH after the registration deadline, which is August 1 for fall, and De- The refund formula measures the actual number of days enrolled FHPEHUIRUVSULQJ$FKDQJHVKRXOGEHUHTXHVWHGDQGDSSURYHG GXULQJWKHVHPHVWHU,WLVGHWHUPLQHGE\GLYLGLQJWKHQXPEHURI E\-XO\IRUIDOODQG1RYHPEHUIRUVSULQJ days enrolled by the number of calendar days in the semester LQFOXGLQJZHHNHQGVDQGKROLGD\VH[FHSW7KDQNVJLYLQJEUHDNDQG spring break. ,IDVWXGHQWLVDUHFLSLHQWRI)HGHUDO7LWOH,9¿QDQFLDODLG refunds to those programs are required by federal law to be the ¿UVWSULRULW\DQGPXVWEHUHWXUQHGLQWKHIROORZLQJRUGHU 8QVXE- sidized Federal Stafford Loan, Subsidized Federal Stafford Loan, Federal Perkins Loan, Federal PLUS Loan, Federal Pell Grant, and Federal SEOG. A student will not be issued a cash refund on any credit balance until the refund calculation process is complete. Any credit bal- ance remaining on the student’s account that is from institutional funds will not be issued as a refund to the student. The following items are non-refundable: Financial Aid 14 )LQDQFLDODVVLVWDQFHDZDUGHGE\'H¿DQFH&ROOHJHFRQVLVWVRI DVIXQGVDUHDYDLODEOH any one or a combination of three types: scholarships and grants, $IWHUWKH)LQDQFLDO$LG2I¿FHKDVUHFHLYHGDOOGRFXPHQWVIURP loans, and/or work study. A complete list of these appears in the WKHVWXGHQWDQGWKHIHGHUDOJRYHUQPHQWWKHSURFHVVRIFDOFXODWLQJ following section. Scholarships and grants may be from Federal, WKH¿QDQFLDODLGSDFNDJHLVUDSLG6WXGHQWVZLOOUHFHLYH¿QDQFLDO State, or College sources, and do not require repayment. Loans DLGDZDUGQRWL¿FDWLRQE\PDLO7KH¿QDQFLDODLGDZDUGPXVWEH DUHDYDLODEOHIURPVHYHUDOSURJUDPVDQGUHTXLUHUHSD\PHQW signed, dated, and returned by the designated reply date. The :RUNVWXG\UHTXLUHVWKDW\RXREWDLQDFDPSXVMRE)XOO\ VLJQHGFRS\DFWLYDWHVWKHGHGXFWLRQRIFKDUJHVIURPWKHVWXGHQW¶V RIIXOOWLPH'H¿DQFH&ROOHJHVWXGHQWVUHFHLYHVRPHIRUPRI ELOO6WXGHQWVKDYHWKHRSWLRQWRDFFHSWRUUHMHFWDQ\SDUWRIWKH ¿QDQFLDODLG DZDUG,IWKHVLJQHGDQGGDWHGFRS\RIWKH¿QDQFLDODLGDZDUGLV QRWUHWXUQHGWR'H¿DQFH&ROOHJHWKHVWXGHQWIRUIHLWVWKHSULYLOHJH )LQDQFLDO$LGLVJLYHQWRVWXGHQWVZKRGHPRQVWUDWH¿QDQFLDO RIUHFHLYLQJWKH¿QDQFLDODLGDZDUGDQGWKHDZDUGZLOOEHPDGH QHHGRUZKRKDYHHDUQHGDVFKRODUVKLSWKURXJKWKHLUDFDGHPLF DYDLODEOHWRRWKHUHOLJLEOHVWXGHQWV RUSHUIRUPDQFHDFKLHYHPHQWV'HPRQVWUDWHGQHHGIRUDJLYHQ school year is based on the family’s income and net assets for the SUHYLRXV\HDUDVUHSRUWHGRQWKH)$)6$ )UHH$SSOLFDWLRQIRU Renewal Financial aid is awarded with the understanding that it may be )HGHUDO6WXGHQW$LG renewed from year to year. Renewal of aid is dependent upon &ROOHJH¿QDQFLDODLGLVDYDLODEOHWKURXJKVFKRODUVKLSVDQG FRQWLQXLQJ¿QDQFLDOQHHGDFDGHPLFSHUIRUPDQFHKRXVLQJVWDWXV JUDQWVSURYLGHGE\FRQWULEXWLRQVIURPLQGLYLGXDOVFRUSRUDWLRQV DQGDYDLODELOLW\RIIXQGV&KDQJHVLQSDUHQWRUVWXGHQWLQFRPH churches, and foundations. Supplementing these restricted funds, DVVHWVKRXVHKROGQXPEHULQFROOHJHDQGFXPXODWLYHJUDGH the College annually sets aside a portion of its unrestricted gift SRLQWDYHUDJHZLOODIIHFWUHQHZDORIIHGHUDOVWDWHDQGFROOHJH aid. Scholarships and some grants require the maintenance of LQFRPHWREHXVHGIRUVWXGHQW¿QDQFLDODLG7KH&ROOHJHRIIHUV ERWKPHULW QRQHHG DQGQHHGEDVHGVFKRODUVKLSDQGJUDQW DVSHFL¿HGJUDGHSRLQWDYHUDJHIRUUHQHZDO$OOVWXGHQWVZKR assistance to students who meet the prescribed criteria. GHVLUHUHQHZDORI¿QDQFLDODLGIRUWKHQH[W\HDUPXVWUHDSSO\E\ submitting the FAFSA by March 1 of each year. Financial aid will not be renewed if this step if not completed. 1HHGEDVHGDLGSDFNDJHVDUHDZDUGHGWRVWXGHQWVRQD³¿UVW come” basis beginning in mid-February for the following DFDGHPLF\HDU7KHDPRXQWRIJUDQWDQGVFKRODUVKLS JLIW DLGLQ SURSRUWLRQWRWKHDPRXQWRIVHOIKHOS ORDQDQGFDPSXVZRUN LQ Aid Categories LQGLYLGXDODLGSDFNDJHVLVGHWHUPLQHGE\WKHDSSOLFDQW¶V¿QDQFLDO Scholarships/grants need, academic record, date of aid application, social standing in *LIWDVVLVWDQFHQRUHSD\PHQW WKH&ROOHJH FLWL]HQVKLSUHFRUG DQGWKHDYDLODELOLW\RIIXQGV Pell Grant:*LIWDVVLVWDQFHIURPWKHJRYHUQPHQWEDVHGRQ GHPRQVWUDWHG¿QDQFLDOQHHG $Q\VWXGHQWZKRKDVGHPRQVWUDWHG¿QDQFLDOQHHGDQGPHHWVWKH SEOG 6XSSOHPHQWDO(GXFDWLRQDO2SSRUWXQLW\*UDQW JLIW minimum academic and conduct standards set by the College is DVVLVWDQFHIURPWKHJRYHUQPHQWEDVHGRQGHPRQVWUDWHG eligible to be considered for the College grant. College grants ¿QDQFLDOQHHG apply to tuition unless designated in the aid award letter to apply OIG 2KLR,QVWUXFWLRQDO*UDQW JLIWDVVLVWDQFHIRU2KLR WRZDUGRWKHU&ROOHJHFRVWV2QO\IXOOWLPH FUHGLWVRUPRUHSHU UHVLGHQWVZKRVKRZ¿QDQFLDOQHHG VHPHVWHU VWXGHQWVDUHHOLJLEOHIRU'H¿DQFH&ROOHJHVFKRODUVKLSV OSCG: 2KLR6WXGHQW&KRLFH*UDQW JLIWDVVLVWDQFHIRU2KLR DQGJUDQWV3DUWWLPHDQGVXPPHUVFKRROVWXGHQWVUHFHLYHWKH UHVLGHQWVZKRKDYHQRWDWWHQGHGFROOHJHDVDIXOOWLPHVWXGHQW ¿QDQFLDOEHQH¿WRIDGLVFRXQWHGWXLWLRQFKDUJHWKHUHIRUHQR EHIRUH-XO\ KDYHQRWHDUQHGDEDFKHORU¶VGHJUHH &ROOHJHIXQGHGVFKRODUVKLSVRUJUDQWVDUHDYDLODEOHIRUSDUWWLPH DQGZKRZLOODWWHQGDSULYDWHFROOHJHLQ2KLR and summer school students. College Grant:*LIWDVVLVWDQFHEDVHGRQ¿QDQFLDOQHHGIRUIXOO WLPHVWXGHQWV,IVWXGHQWVPRYHRIIFDPSXVRUGRQRW Application participate in the college meal plan, the college grant will be reduced. 6WXGHQWVPXVW¿UVWDSSO\IRUDGPLVVLRQWRWKH&ROOHJH7KH recommended deadline for application is March 1. Graduate, Campus work allowance: Opportunity to earn dollars and Adolescent and Young Adult Licensure, or second bachelor obtain work experience on campus. Students who are interested degree students enrolled full-time must complete a Free LQ¿QGLQJMREVVKRXOGFRPHWRWKH)LQDQFLDO$LG2I¿FHGXULQJ Application for Student Aid (FAFSA) to be considered for GHVLJQDWHGWLPHVWRFKHFNWKHOLVWRIDYDLODEOHMREV6WXGHQWV Stafford loans and need based aid. Need based Defiance ZLOOEHQRWL¿HGRIWKRVHWLPHV$ZRUNDOORZDQFHGRHV127 College Grant will be determined by the EFC. The FAFSA is PHDQDJXDUDQWHHGMRE DYDLODEOHDWDQ\FROOHJHVWDWHXQLYHUVLW\RUKLJKVFKRRO)$)6$V VXEPLWWHGDIWHU0DUFKDUHFRQVLGHUHGDVWKH\DUHUHFHLYHGDQG Financial Aid 15 Loans %RUURZHGDVVLVWDQFHPXVWEHUHSDLG SURYLGHGWKHUHFLSLHQWPDLQWDLQVWKHUHTXLUHGFXPXODWLYHJUDGH Plus Loan: 3DUHQW/RDQIRU8QGHUJUDGXDWH6WXGHQW /RDQ SRLQWDYHUDJH*UDGHUHYLHZVDUHFRPSOHWHGRQFHD\HDUDWWKH DSSOLFDWLRQVDUHDYDLODEOHDWDFUHGLWXQLRQRUEDQN&UHGLW HQGRIWKHVSULQJWHUP0RUHGHWDLOVRQUHQHZDOVDUHDYDLODEOH DSSURYDOPXVWEHFRPSOHWHGEHIRUHDORDQFDQEHGLVEXUVHG upon request. ,QWHUHVWUDWHVYDU\HYHU\\HDU5HSD\PHQWEHJLQVGD\VDIWHU the last disbursement. Outside Scholarships 8QOHVVRWKHUZLVHVSHFL¿HGE\WKHGRQRUVDGGLWLRQDOQRQ&ROOHJH Federal Stafford Loan gift aid will be treated as follows. The scholarship will replace Subsidized: $ORDQJXDUDQWHHGE\WKH)HGHUDOJRYHUQPHQW H[LVWLQJVHOIKHOSDLG LHORDQRUZRUN RUXQPHWQHHG ZKLFKLV EDVHGRQQHHG7KHJRYHUQPHQWSD\VWKH interest as long as the student attends college at least half-time. 3OHDVHVXEPLWWRWKH)LQDQFLDO$LG2I¿FHQRWL¿FDWLRQRIDQ\ Repayment begins six months after the student ceases to be RXWVLGHVFKRODUVKLSDVVRRQDV\RXKDYHNQRZOHGJHRIWKH enrolled at least half-time or six credits each semester. award. Acceptable documentation will include a letter from Unsubsidized: $ORDQJXDUDQWHHGE\WKH)HGHUDOJRYHUQPHQW WKHRUJDQL]DWLRQWKDWVSHFL¿HVWKHWHUPVRIWKHVFKRODUVKLS which is not based on need. Students are responsible for the total dollar amount, and renewal information. This should be interest charge while attending school. Deferring the interest is submitted no later that June 15 to ensure that the award will be an option. Repayment, interest, and deferment details will be credited to your account in the Registration Center. SURYLGHGE\WKHOHQGHU6WXGHQWVPD\TXDOLI\IRURQHRUERWKRI the Federal Stafford Loans. Repayment begins 6 months after the 9HUL¿FDWLRQ student ceases to be enrolled at least half-time or six credits each $VWXGHQWZKRLVVHOHFWHGIRUYHUL¿FDWLRQPXVWFRPSOHWH VHPHVWHU,QWHUHVWUDWHVYDU\HYHU\\HDU DGGLWLRQDOGRFXPHQWDWLRQ6HOHFWLRQIRUYHUL¿FDWLRQLVQRUPDOO\ performed by the U.S. Department of Education. This federal Federal Perkins Loan: A loan guaranteed by the federal requirement includes submitting Federal Tax Returns and JRYHUQPHQWEDVHGRQIHGHUDOQHHG,QWHUHVWUDWHLVDQG D9HUL¿FDWLRQ:RUNVKHHWWRWKH)LQDQFLDO$LG2I¿FH7KH repayment begins 9 months after a student ceases to be enrolled DGGLWLRQDOGRFXPHQWDWLRQYHUL¿HVWD[DEOHLQFRPHXQWD[HG at least half-time. Upon graduation or separation, the student income, household size and number enrolled in college. must complete an online "exit" loan counseling packet at www. 9HUL¿FDWLRQPXVWEHFRPSOHWHGEHIRUHDQ\IHGHUDO¿QDQFLDODLG XDVHUYLFHFRP5HSD\PHQWDQGORDQEHQH¿WLQIRUPDWLRQLV FDQEHGLVEXUVHG7KH)LQDQFLDO$LG2I¿FHZLOOQRWLI\VWXGHQWV DYDLODEOHIURPWKH'LUHFWRURI5HJLVWUDWLRQ6HUYLFHV3D\PHQWV ZKRDUHVHOHFWHGIRUYHUL¿FDWLRQZLWKDQ$GGLWLRQDO,QIRUPDWLRQ DUHPDLOHGWRWKHELOOLQJVHUYLFHUXVHGE\WKH&ROOHJH0DLOWR Sheet. Documents must be submitted by the beginning of the 8QLYHUVLW\$FFRXQWLQJ6HUYLFH,QF3D\PHQW3URFHVVLQJ'HSW VHPHVWHU)DLOXUHWRFRPSOHWHWKHYHUL¿FDWLRQSURFHVVPD\UHVXOW 32%R[ %URRN¿HOG:, LQDQDGPLQLVWUDWLYHZLWKGUDZDO Revisions of Aid Packages Enrollment and Eligibility 7KH)LQDQFLDO$LG2I¿FHKDVWKHULJKWWRUHYLVH¿QDQFLDODLG )ROORZLQJDUHWKHHQUROOPHQWUHTXLUHPHQWVIRUWKHYDULRXV packages according to federal, state, and institutional policies and aid programs. If a student changes enrollment after the aid is UHJXODWLRQV$LGDZDUGVZLOOEHUHYLVHGZKHQWKHUHDUHFKDQJHVLQ DZDUGHGWKHDLGPD\EHDGMXVWHG originally reported information or when additional scholarships ANY ENROLLMENT LEVEL DUHUHFHLYHG Pell Grant AT LEAST HALF TIME FUHGLWVSHUVHPHVWHU SEOG, Perkins, Campus Work, Stafford, Plus Loans Satisfactory Academic Progress FULL-TIME FUHGLWVRUPRUHSHUVHPHVWHU $OO¿QDQFLDODLGSURJUDPVUHTXLUHVWXGHQWVWRPDNH³VDWLVIDFWRU\´ 2KLR,QVWUXFWLRQDO*UDQW JHQHUDOO\ progress toward earning their degrees. Students are making Ohio Student Choice Grant, VDWLVIDFWRU\SURJUHVVLIWKH\D PDLQWDLQ³JRRGDFDGHPLF 'H¿DQFHJUDQWVDQGVFKRODUVKLSV VWDQGLQJ´DVGHWHUPLQHGE\WKH&ROOHJH¶VDFDGHPLFSROLFLHVE complete the number of credits required for their enrollment VWDWXVDQGF FRPSOHWHWKHLUGHJUHHVZLWKLQWKHPD[LPXPWLPH Financial Aid Policies allowed. Renewal of Financial Aid 6WXGHQWVPXVWUHDSSO\HYHU\\HDUIRU¿QDQFLDODLGFRQVLGHUDWLRQ D 7KHJUDGHSRLQWDYHUDJHUHTXLUHPHQWVIRU³JRRGDFDGHPLF 7KHSULRULW\¿OLQJGDWHLV0DUFK VWDQGLQJ´DUHGHVFULEHGRQSDJHRIWKH'H¿DQFH&ROOHJH Catalog. Scholarship/Grant Renewals 'H¿DQFH&ROOHJHDFDGHPLFVFKRODUVKLSVDUHUHQHZHGHYHU\\HDU Financial Aid 16 E 6WXGHQWVDUHUHTXLUHGWRFRPSOHWHWKHIROORZLQJQXPEHURI FUHGLWVDFFRUGLQJWRWKHHQUROOPHQWVWDWXVRQZKLFKWKH\UHFHLYH ¿QDQFLDODLG Minimum number of credits Aid Status At least 12 per semester Full time RUE\WKHHQGRIVSULQJWHUP At least 8 per semester Three quarter time RUE\WKHHQGRIVSULQJWHUP At least 6 per semester Half time RUE\WKHHQGRIVSULQJWHUP Those who do not complete the minimum number of credits UHTXLUHGZLOOKDYHGH¿FLHQWKRXUV)RUH[DPSOHLIDVWXGHQW UHFHLYHVDLGDVDIXOOWLPHVWXGHQWKHVKHLVUHTXLUHGWRFRPSOHWH DWOHDVWFUHGLWVSHUDFDGHPLF\HDU IDOODQGVSULQJ ,IWKDW VWXGHQWRQO\FRPSOHWHVKHVKHZLOOKDYHGH¿FLHQWKRXUV 3URYLGHGWKDWWKHVWXGHQWLVLQJRRGDFDGHPLFVWDQGLQJDQGKDV not exceeded the maximum time allowed for his/her degree, the IROORZLQJDFWLRQVZLOOEHWDNHQEDVHGRQWKHQXPEHURIGH¿FLHQW credits. 2QH WRHLJKW GH¿FLHQWFUHGLWV Student is placed on )LQDQFLDO$LG3UREDWLRQ6WXGHQWFDQFRQWLQXHUHFHLYLQJ¿QDQFLDO aid if otherwise eligible. 0RUHWKDQHLJKW GH¿FLHQWFUHGLWV Student is no longer HOLJLEOHIRU¿QDQFLDODLG F $GGLWLRQDOO\XQGHUJUDGXDWHVWXGHQWVDUHH[SHFWHGWRFRPSOHWH WKHLU%DFKHORUGHJUHHVLQIXOOWLPHHTXLYDOHQW semesters. Graduate students are expected to complete WKHLU0DVWHUVLQIXOOWLPHHTXLYDOHQWVHPHVWHUV$OOFROOHJH HQUROOPHQWSHULRGVDW'H¿DQFH&ROOHJHRUDWRWKHUVFKRROVZLOO be counted toward the maximum time allowed for the completion RIWKHGHJUHHUHJDUGOHVVRIZKHWKHUDLGZDVUHFHLYHGGXULQJ those periods. Exception will be made for enrollment periods DW'H¿DQFH&ROOHJHGXULQJVXPPHUWHUPVLIDLGLVQRWUHFHLYHG during those terms. 7KH)LQDQFLDO$LG2I¿FHVKDOOPRQLWRUDFDGHPLFSURJUHVVDW the end of each spring semester. Students placed on academic VXVSHQVLRQVWXGHQWVZKRKDYHH[FHVVLYHGH¿FLHQF\FUHGLWVDQG VWXGHQWVZKRKDYHUHDFKHGWKHPD[LPXPWLPHDOORZHGDUHQR ORQJHUHOLJLEOHWRUHFHLYH¿QDQFLDODLGXQOHVVWKH\DSSHDODQGDUH granted an exception by the Director of Financial Aid. Student Life 17 Student Handbook VSHFL¿FMRERSHQLQJVDQGZRUNVZLWKDUHDEXVLQHVVHVLQSURYLGLQJ 7KH6WXGHQW+DQGERRNDQH[WHQVLRQRIWKH'H¿DQFH&ROOHJH VWXGHQWVRSSRUWXQLWLHVWRLQWHUYLHZIRUERWKIXOOWLPHDQG &DWDORJFRQWDLQVIXUWKHUGHWDLOVDERXWVWXGHQWOLIHDW'H¿DQFH SDUWWLPHHPSOR\PHQW&DUHHUVHUYLFHVDUHDYDLODEOHWR'H¿DQFH College as well as complete information on rules and regulations graduates as well as to currently enrolled students. Among other JRYHUQLQJVWXGHQWEHKDYLRU$FRS\RIWKH6WXGHQW+DQGERRNFDQ IXQFWLRQVWKH2I¿FHVHQGVUHJLVWHUHGDOXPQLLQIRUPDWLRQRQMRE EHREWDLQHGLQWKH2I¿FHRI6WXGHQW/LIH RSHQLQJVLQWKHLU¿HOGVRIIHUVFDUHHUFRXQVHOLQJNHHSVDOXPQL DEUHDVWRIWKHODWHVWWUHQGVDQGPDLOVUHIHUHQFHVWRSURVSHFWLYH employers. 'H¿DQFH&ROOHJH&DPSXV&RYHQDQW* 'H¿DQFH&ROOHJHLVDFRPPXQLW\RIOHDUQHUVGHGLFDWHGWRQXUWXU- Academic Advising ing the whole person of each of its members. We seek to inspire 'H¿DQFH&ROOHJHHQFRXUDJHVFORVHDWWHQWLRQWRLQGLYLGXDOV$W a commitment to know the truth, to understand our world, and the WKHFRUHRIWKLVLQGLYLGXDOFRQFHUQLVWKHDGYLVRU\V\VWHPDQG GLYHUVHFXOWXUHVZLWKLQLWWROHDGZLWKLQRXUSURIHVVLRQVDQGWR DFFHVVWRSURIHVVRUV1HZVWXGHQWVEHORZWKHDJHRIZKRKDYH VHUYHRXUIDPLOLHVRXUFRPPXQLWLHVDQGRXUZRUOGDVUHVSRQVLEOH not had a successful college experience elsewhere are required citizens. WRWDNH)6)UHVKPDQ6HPLQDULQWKHLU¿UVWVHPHVWHURIVWXG\ 7KH)UHVKPDQ6HPLQDULQVWUXFWRUEHFRPHVWKHLUDGYLVRUGXULQJ $VDPHPEHURIWKH'H¿DQFH&ROOHJHFRPPXQLW\« WKH¿UVWVHPHVWHU,IVWXGHQWVKDYHGHFODUHGDPDMRUWKH\ZLOOEH DVVLJQHGDIDFXOW\DGYLVRULQWKDWGLVFLSOLQHDWWKHFRPSOHWLRQ I will respect the dignity and worth of each person. RIWKH¿UVWVHPHVWHU,IWKH\DUHXQVXUHRIWKHLUPDMRUWKH\ZLOO I will recognize the importance of interpersonal relationships EHDGYLVHGE\WKH2I¿FHRI&DUHHUDQG6WXGHQW$VVLVWDQFHLQ and of a caring community. Hubbard Hall. I will strongly advocate honest and open intellectual inquiry and academic freedom. :HHNHQG&ROOHJHVWXGHQWVDUHDGYLVHGE\WKH'LUHFWRURI I will trust that truths, in all their complexities, are ultimately Weekend College with assistance by the professors teaching in interrelated. WKHSURJUDP2WKHUSDUWWLPHVWXGHQWVDUHDVVLJQHGPDMRUDGYLVRUV I will move beyond tolerance and acceptance to understand DQGFDQUHFHLYHVXSSOHPHQWDODGYLVLQJLQWKH2I¿FHRI&DUHHU ing and appreciation of religious, cultural, and DQG6WXGHQW$VVLVWDQFH(YHQLQJKRXUVDUHPDLQWDLQHGWRSURYLGH individual diversity. VHUYLFHWRVWXGHQWVWDNLQJRQO\HYHQLQJFODVVHV I will recognize the privilege and responsibility of my stew ardship for individuals, for institutions, and for the 6WXGHQWVGHFODUHPDMRUVDQGPD\UHTXHVWDQDGYLVRUFKDQJHLQ resources of the natural world. WKH5HJLVWUDU¶VRI¿FH I will commit myself to serving others as an expression of IDLWKDQGDZD\RIOLIHHQULFKPHQWDQGIXO¿OOPHQW Students are encouraged to work closely with their academic DGYLVRUVWKURXJKRXWWKHLUFROOHJHFDUHHUV$GYLVRUVDUHSUHSDUHG 7KLVVWDWHPHQWLVLQWHQGHGDVDUHÀHFWLRQRIWKHFHQWUDOYDOXHVRI QRWRQO\WRFRXQVHOVWXGHQWVRQVHOHFWLRQRIFRXUVHVDQGRYHUDOO 'H¿DQFH&ROOHJH,WLVGHVLJQHGWREHGLVFXVVHGDQGVXSSRUWHG workload, but to refer them to important resources such as the E\WKHHQWLUH'H¿DQFH&ROOHJHFRPPXQLW\ZLWKWKHXQGHUVWDQGLQJ 2I¿FHRI&DUHHUDQG6WXGHQW$VVLVWDQFHRUWRDUUDQJHIRUWXWRULQJ WKDWLWLVDOZD\VD³ZRUNLQSURJUHVV´ when assistance is needed. $GDSWHGIURPWKH8QLYHUVLW\RI6RXWK&DUROLQD¶V7KH&DUROLQ- ian CreedDQGIURPWKH'H¿DQFH&ROOHJHVWDWHPHQWRIFRYHQDQWDO Tutoring and Other Academic Support status as a United Church of Christ related college. Services 7XWRULQJDQGRWKHUDFDGHPLFVXSSRUWVHUYLFHVVXFKDVDVVLVWDQFH with media/technology related assignments and textbooks on Career and Student Assistance WDSHDUHDYDLODEOHWKURXJKWKH7$*&HQWHU &HQWHUIRU7HDFKLQJ 7KH2I¿FHRI&DUHHUDQG6WXGHQW$VVLVWDQFHORFDWHGLQ+XEEDUG DQG$FDGHPLF*URZWK 7KHVHVHUYLFHVLQDGGLWLRQWRRWKHUVDUH +DOOSURYLGHVKHOSWRWKRVHVWXGHQWVZKRDUHXQGHFLGHGDERXWD SURYLGHGIUHHRIFKDUJHWRVWXGHQWV7KH7$*&HQWHULVORFDWHGLQ career. By focusing on interests and abilities and through career Dana Hall room 25. counseling, students are assisted with making career choices. This LVDQRQJRLQJSURFHVVWKDWPD\EHJLQHYHQEHIRUHWKHVWXGHQWV Accommodations Policy for Students DUULYHRQFDPSXV7KURXJKZRUNVKRSVFODVVURRPSUHVHQWDWLRQV DQGLQGLYLGXDOFRXQVHOLQJVWXGHQWVUHFHLYHLQIRUPDWLRQRQDOO aspects of career planning and placement. Assistance with resume SUHSDUDWLRQLQWHUYLHZWHFKQLTXHVDQGMREUHIHUUDOLQIRUPDWLRQLV SURYLGHGE\WKH2I¿FH7KH2I¿FHPDLQWDLQVDFXUUHQWOLVWLQJRI Student Life 18 with Disabilities GLVWLQJXLVKHGWKHPVHOYHVDFDGHPLFDOO\E\UDQNLQJLQWKHWRS 7KHRI¿FHRI6WXGHQW5HWHQWLRQDQGWKH7HDFKLQJDQG$FDGHPLF SHUFHQWRIWKHMXQLRURUVHQLRUFODVV'H¿DQFH&ROOHJHDOVR *URZWK 7$* &HQWHUDW'H¿DQFH&ROOHJHZRUNWRHQVXUH SDUWLFLSDWHVLQ7DX0XIRUVRFLDOZRUNPDMRUV7DX3L3KLIRU WKDWHQUROOHGVWXGHQWVUHFHLYHUHDVRQDEOHDFFRPPRGDWLRQVIRU EXVLQHVVHFRQRPLFVPDMRUVDQG3KL$OSKD7KHWDIRUKLVWRU\ GRFXPHQWHGGLVDELOLWLHVLQFRPSOLDQFHZLWKWKHSURYLVLRQVRIWKH PDMRUV $PHULFDQVZLWK'LVDELOLWLHV$FW $'$ RI DQG6HFWLRQ of the Rehabilitation Act of 1973. The purpose of accommodation Civil Rights Racial Harassment Policy LVWRSURYLGHHTXDODFFHVVWRHGXFDWLRQDORSSRUWXQLWLHVWRVWXGHQWV 'H¿DQFH&ROOHJHLVFRPPLWWHGWRPDLQWDLQDKXPDQHDWPRVSKHUH with disabilities, and the college does not intend that academic in which the race, color, creed, religion, sexual orientation, marital standards be altered, nor that essential elements of programs status, national or ethnic origin, physical or mental handicap or or courses be changed. All requests for accommodations are YHWHUDQVWDWXVRIDQLQGLYLGXDORUJURXSDUHUHVSHFWHGDQGQRW HYDOXDWHGRQDQLQGLYLGXDOEDVLV,WLVWKHUHVSRQVLELOLW\RI GLVSDUDJHG'H¿DQFH&ROOHJHZLOOQRWWROHUDWHDQ\DFWVRIUDFLDO VWXGHQWVZLWKGLVDELOLWLHVWRVHHNDYDLODEOHDVVLVWDQFHDWWKH harassment or discrimination. The college will promptly and Teaching and Academic Growth Center and to make their needs WKRURXJKO\LQYHVWLJDWHDOODOOHJDWLRQVRIUDFLDOKDUDVVPHQWDQG known. discrimination. The college will take any action necessary against DQLQGLYLGXDO V IRXQGJXLOW\RIUDFLDOKDUDVVPHQWRUGLVFULPLQDWLRQ Disabilities LQRUGHUWRPDLQWDLQDKDUPRQLRXVFDPSXVHQYLURQPHQW According to the Americans with Disabilities Act, a person with a 'LVFULPLQDWLRQLVGH¿QHGDVEHKDYLRURUFRQGXFWWKDWWHQGVWR disability is one who: GHPHDQRUGLVSDUDJHDQLQGLYLGXDORQWKHEDVLVRIUDFHFRORUFUHHG has a physical or mental impairment which substantially religion, sexual orientation, marital status, national or ethnic origin, OLPLWVDPDMRUOLIHDFWLYLW\ SK\VLFDORUPHQWDOKDQGLFDSRUYHWHUDQVWDWXV has a record of history of such impairment, or $Q\VWXGHQWZKRLVDZLWQHVVWRRUYLFWLPRIUDFLDOKDUDVVPHQWRU LVUHJDUGHGDVKDYLQJVXFKDQLPSDLUPHQW GLVFULPLQDWLRQLQYROYLQJVKRXOGLPPHGLDWHO\QRWLI\WKH6WXGHQW /LIH2I¿FH7KHSURFHGXUHVDUHIRXQGLQWKH6WXGHQW/LIH+DQG- Documentation ERRN The Teaching and Academic Growth Center will ask for GRFXPHQWDWLRQWRYHULI\WKHGLVDELOLW\DQGLIDSSURSULDWHZLOO Commencement FRRSHUDWHZLWKWKH2I¿FHRI6WXGHQW5HWHQWLRQLQHVWDEOLVKLQJDQG &RPPHQFHPHQWLVDFROOHJHFHUHPRQ\WKDWKRQRUVWKHDFKLHYH- WUDFNLQJDSSURSULDWHVXSSRUWVHUYLFHV ments of graduating seniors and their families. Those who wish not to participate must ask to be excused by the Academic Dean, 1RDFFRPPRGDWLRQVZLOOEHSURYLGHGZLWKRXWGRFXPHQWDWLRQ who may or may not grant the request. ,QDGGLWLRQ'H¿DQFH&ROOHJHZLOOEHXQDEOHWRSURYLGH DFFRPPRGDWLRQVLQWKHFODVVURRPLIWKHVWXGHQWGRHVQRWJLYH Computer Policy permission to notify Faculty that accommodations are needed. ,QIRUPDWLRQV\VWHPV LQFOXGLQJFRPSXWHUVFRPSXWHUDFFRXQWV Information regarding a student’s disability is considered SULQWHUVQHWZRUNVVRIWZDUHHOHFWURQLFPDLOLQWHUQHWDFFHVV DW FRQ¿GHQWLDO,QIRUPDWLRQZLOOQRWEHUHOHDVHGWRDQ\RQHZLWKRXW 'H¿DQFH&ROOHJHDUHSURYLGHGIRUWKHXVHRI'H¿DQFH&ROOHJH WKHH[SUHVVZULWWHQSHUPLVVLRQRIWKHVWXGHQW1RWL¿FDWLRQWR students, faculty and staff in support of the College’s academic Faculty can be accomplished without disclosing the exact nature DQGDGPLQLVWUDWLYHSURJUDPV$OOVWXGHQWVIDFXOW\DQGVWDIIDUH of the disability. responsible for seeing that these systems are used in an effec- WLYHHI¿FLHQWHWKLFDODQGODZIXOPDQQHU7KHXVHRILQIRUPDWLRQ Reasonable Accommodations V\VWHPVLVDSULYLOHJHQRWDULJKWDQGPD\EHUHYRNHGDWDQ\ $FFRPPRGDWLRQVDUHSURYLGHGRQDQLQGLYLGXDOEDVLV time for misuse. All access to the College’s computing resources, $FFRPPRGDWLRQVDUHSURYLGHGWRVXSSRUWWKH LQFOXGLQJWKHLVVXLQJRIDFFRXQWVPXVWEHDSSURYHGWKURXJKWKH HGXFDWLRQDOGHYHORSPHQWRIVWXGHQWVZLWKGLVDELOLWLHV &RPSXWHU6HUYLFHV2I¿FH8VDJHSROLFLHVFDQEHIRXQGLQWKH Student Handbook. ,QDGGLWLRQWRWKHDFDGHPLFVXSSRUWVHUYLFHVDYDLODEOH WRDOO'H¿DQFH&ROOHJHVWXGHQWVVRPHH[DPSOHVRI reasonable accommodations include extended time for Sexual/Gender Harassment Statement tests, administration of oral tests, note-taking 7KHFROOHJHVHHNVWRFUHDWHDQGPDLQWDLQDQDFDGHPLFHQYLURQ- DVVLVWDQFHDQGXVHRIDVVLVWLYHGHYLFHVVXFKDV ment in which all members of the community are free of harass- calculators or computers. PHQWEDVHGRQJHQGHURUVH['H¿DQFH&ROOHJHHVSRXVHVYDOXHV Detailed information on accommodation is available from the which infuse the academic and residential life on its campus. TAG center. Anintegral community life must be the awareness on the part of Academic and Honor Societies $OSKD&KLDFFHSWVLQWRPHPEHUVKLSWKRVHVWXGHQWVZKRKDYH Student Life 19 HYHU\PHPEHURIWKHULJKWVDQGKXPDQGLJQLW\RIHYHU\PHP- ber. Attitudes of condescension, hostility, role-stereotyping, and sexual innuendo weaken the health of the community. Further- more, harassment based on sex or gender compromises the integrity of a liberal arts education because it makes the learning DQGZRUNLQJHQYLURQPHQWKRVWLOHLQWLPLGDWLQJDQGRIIHQVLYH LW GHVWUR\VRSSRUWXQLWLHVIRUVWXGHQWVWRGHYHORSVWURQJSRVLWLYH VHOIFRQFHSWVDQGWKHVHQVHRIVHOIFRQ¿GHQFHZKLFKLVHVVHQWLDO WROLYLQJRXWWKHLGHDOVRIDOLEHUDOHGXFDWLRQ,QDGGLWLRQSHUVRQV who harass others compromise their own integrity and credibility. Consequently, no unlawful form of sexual or gender harassment can be tolerated. 6H[XDOKDUDVVPHQWLVGH¿QHGDVXQZHOFRPHVH[XDODGYDQFHVRU DVFRHUFLYHEHKDYLRUZKLFKWKUHDWHQVHPSOR\PHQWRUDFDGHPLF reprisal, or promises rewards contingent upon obtainment of VH[XDOIDYRUVRUDVVSUHDGLQJIDOVHVWRULHVDERXWDSHUVRQ¶VVH[XDO KDUDVVPHQW*HQGHUGLVFULPLQDWLRQLVGH¿QHGDVGHURJDWRU\UHIHU- ences to gender and/or unequal treatment based on gender. 6WXGHQWVZKREHOLHYHWKH\KDYHEHHQWKHREMHFWRIJHQGHU discrimination, or gender or sexual harassment, may inform the 6WXGHQW/LIH2I¿FHWKHLUDFDGHPLFDGYLVRURUDSSURSULDWHFRXQ- VHOLQJVHUYLFHV Pilgrim Library Services The Pilgrim Library promotes a comfortable study atmosphere by SURYLGLQJLQGLYLGXDOVWXG\FDUUHOVJURXSVWXG\URRPVDFRIIHH shop, and lounge area. Resources include books, magazines, MRXUQDOVQHZVSDSHUVFRPSDFWGLVFVUHFRUGVDXGLRFDVVHWWHV YLGHRFDVVHWWHVDQGPLFURIRUPV7KH/LEUDU\SURYLGHVDFFHVVWR SKRWRFRSLHUVUHDGHUSULQWHUW\SHZULWHUVDXGLRYLVXDOHTXLSPHQW DQGDFRPSXWHUODE7KH3LOJULP/LEUDU\RIIHUVRYHUHLJKW\GDWD- bases many of which contain full-text articles or links to full-text GRFXPHQWV7KHUHDUHVL[OLEUDU\VWDIIPHPEHUVDYDLODEOHWRDV- VLVWVWXGHQWVDQGIDFXOW\)RULQIRUPDWLRQRQWKH/LEUDU\ VKRXUV of operation, please refer to the student handbook, the college website, the sign in the entrance to the library, or call 419-783- 2481. Academic Life 20 Academic Year Programs 'H¿DQFH&ROOHJHRSHUDWHVRQDVHPHVWHUFDOHQGDUFRQVLVWLQJRI Weekend College two sixteen-week semesters. The fall semester runs from late Master of Business and Organizational Leadership $XJXVWWRPLG'HFHPEHU WKHVSULQJVHPHVWHUUXQVIURPHDUO\ Master of Business and Organizational Leadership January to early May. Criminal Justice Track Master of Arts in Education During the fall and spring semesters, students normally take four RU¿YHFRXUVHVZKLFKW\SLFDOO\DUHWKUHHRUIRXUFUHGLWVHDFK Master of Arts in Education Graduate Adolescent and totaling approximately 15 credits. Young Adult Licensure Program Master of Arts in Education Professional Enrichment 0RVWFRXUVHVDUHZRUWKWKUHHFUHGLWVDOWKRXJKWKH¿JXUHFDQ DQG5HQHZDO&RXUVHV 3(5& range from one to four. For a bachelor degree, 120 credits of Master of Arts in Education - Sports Science Track satisfactory academic work are required. For an associate degree, 60 credits of satisfactory academic work are required. Weekend College Weekend College is designed for adults who are interested in HDUQLQJDEDFKHORU VGHJUHHLQDFKDOOHQJLQJEXWÀH[LEOHIRUPDW Summer Session The goal is for participants in Weekend College to become a The College offers a summer program from early May through FRPPXQLW\RIOHDUQHUVZKRVKDUHFRPPRQJRDOVKDYHVLPLODU PLG$XJXVWFRQVLVWLQJRIWZR¿YHZHHNVHVVLRQVDQGD life experiences and will support each other in the learning workshop session. Most summer session courses are the same SURFHVV7KHHYHU\RWKHUZHHNHQGVFKHGXOHDOORZVRSSRUWXQLW\ as those offered during the regular academic year, while others for study and library work while handling work and family are offered only in the summer. The summer session schedule is obligations. XVXDOO\DYDLODEOHLQODWH'HFHPEHURUHDUO\-DQXDU\ %DFKHORU VGHJUHHVDUHRIIHUHGLQ0DQDJHPHQW%XVLQHVV$GPLQ- Evening Session LVWUDWLRQ$FFRXQWLQJ,QIRUPDWLRQ7HFKQRORJ\ %XVLQHVV7UDFN 7KH&ROOHJHRIIHUVD\HDUURXQGHYHQLQJVFKRROSURJUDP Human Resource Management, Finance, and a completion pro- SULPDULO\WRVHUYHFLWL]HQVRI1RUWKZHVW2KLR$OOUHTXLUHPHQWV JUDPLQ2UJDQL]DWLRQDO6XSHUYLVLRQDQG/HDGHUVKLS$OVRRIIHUHG IRUEXVLQHVVDGPLQLVWUDWLRQPDMRUVFDQEHFRPSOHWHGE\DWWHQGLQJ is an Associate Degree in Business Administration and a minor in HYHQLQJVFKRRODORQH EXWIRURWKHUPDMRUVVWXGHQWVZLOOKDYHWR Information Technology. spend some time in the regular daytime academic program. Three Weekend College terms are offered: a fall term between Center for Adult and Graduate Programs /DERU'D\DQG&KULVWPDV DVSULQJWHUPEHWZHHQ1HZ 6HUYLFHVWKDWDUHSURYLGHGLQFOXGH: Graduate Programs 'H¿DQFH&ROOHJHRIIHUVWZRPDVWHUGHJUHHV,QIRUPDWLRQDERXW Admissions and Financial Aid for part-time adult these degrees, admissions and requirements, is in the Graduate students &DWDORJDYDLODEOHIURPWKH&HQWHUIRU$GXOWDQG*UDGXDWH ([WHQGHGRI¿FHKRXUV Programs. Scheduling of classes 5HFHLYLQJRISD\PHQWRIIHHV 7KH0DVWHURI%XVLQHVVDQG2UJDQL]DWLRQDO/HDGHUVKLS 0%2/ New student orientation GHJUHHLVGHVLJQHGWRSURYLGHOHDGHUVKLSVNLOOVDQGWUDLQLQJ for students and the community by utilizing the strength of Bi-weekly electronic newsletter “The Buzz” WKHHVWDEOLVKHGOLEHUDODUWVEDVHRIWKHFROOHJHLQDQLQQRYDWLYH 6WXGHQW,GHQWL¿FDWLRQFDUGVDQGFRPSXWHUDFFHVV and interdisciplinary manner within the context of a business information SURJUDP,WLVEURDGO\DSSURSULDWHIRUSUR¿WQRQSUR¿WDQG Student Liaison program JRYHUQPHQWDORUJDQL]DWLRQV7KHGHJUHHUHTXLUHVVHPHVWHU 6RFLDO$FWLYLWLHV KRXUVDQGLVRIIHUHGLQFRQMXQFWLRQZLWKWKH:HHNHQG&ROOHJH Information/Referral for all campus needs Program. The MBOL Criminal Justice Track is designed to SURYLGHWKHDERYHPHQWLRQHGVWUHQJWKVWRFULPLQDOMXVWLFH Luncheon Series SURIHVVLRQDOVLQRUPRYLQJWRZDUGPDQDJHPHQWSRVLWLRQVZLWKLQ FULPLQDOMXVWLFHDJHQFLHV Academic Life 21 Forensic Science 7KH0DVWHURI$UWVLQ(GXFDWLRQGHJUHHLVGHVLJQHGWRSURYLGH Health Education classroom teachers with skills and competencies to prepare them Information Technology for expert teaching and leadership in their schools. The degree Integrated Language Arts requires 33 semester hours of graduate courses. Students with Integrated Mathematics content compatible bachelor degrees can also earn Adolescent Integrated Social Studies and Young Adult Teacher Licensure through graduate study. Life Science &RXUVHVDUHRIIHUHGHYHQLQJVDQGZHHNHQGVHDFKWHUPDQGLQ Life Science and Chemistry three summer sessions. A Sports Science track is designed to Mathematics SURYLGHWKHDERYHPHQWLRQHGVWUHQJWKVRIWKH0DVWHURI$UWV Medical Technology in Education program with emphasis on coursework related to Middle Childhood Education coaching, teaching, and/or administration within a sport setting. Natural Science 7KH3URIHVVLRQDO(QULFKPHQWDQG5HQHZDO&RXUVHV 3(5& Physical Education series is a set of workshops that offer educators an HI¿FLHQWZD\ Psychology to stay abreast of current trends and topics in education and to Restoration Ecology OHDUQVNLOOVUHODWHGWRVSHFL¿FFXUULFXODURUOHDUQLQJDUHDV Self-designed Social Work )RUPRUHLQIRUPDWLRQDERXWWKHSURJUDPVDQGVHUYLFHVWKDWWKH Sport Management &HQWHUIRU$GXOWDQG*UDGXDWH3URJUDPVSURYLGHFDOOWKH&$3 Visual Arts RI¿FHDW RUHPDLOFDS#GH¿DQFHHGX. Wellness and Corporate Fitness In addition, programs are available in: Baccalaureate Curriculum Pre-professional 'H¿DQFH&ROOHJHDZDUGVWKH%DFKHORURI6FLHQFHRU%DFKHORURI Pre-Dentistry $UWVGHJUHHVDVGHWHUPLQHGE\WKHPDMRU¿HOGRIVWXG\GHVLJQDWHG Pre-Law in the following lists. A student may earn the degree other than Pre-Medicine WKDWGHVLJQDWHGIRUKLVKHUPDMRUE\FRPSOHWLQJDPLQRULQRQHRI Pre-Seminary WKHGLVFLSOLQHVOLVWHGIRUWKHGHVLUHGGHJUHH7KHVWXGHQWPXVW¿OH Pre-Veterinary a change of degree request in the Registration Center. Bachelor of Arts Associate Degree Curriculum Accounting 'H¿DQFH&ROOHJHRIIHUV$VVRFLDWHRI$UWVGHJUHHVLQWKH Art IROORZLQJ¿HOGV Arts and Humanities Art Business Administration Business Administration Christian Education Criminal Justice Communication Arts Graphic Design Finance Information Technology Graphic Design Religious Education: Design for Leadership History Self-Designed Human Resource Management Management $OO¿HOGVH[FHSW5HOLJLRXV(GXFDWLRQVKDUHWKHGHJUHH Marketing requirement of 60 credits, to include instruction in composition. Multimedia Communications 2UJDQL]DWLRQDO/HDGHUVKLSDQG6XSHUYLVLRQ 7KH&ROOHJHPDNHVHYHU\HIIRUWWRVFKHGXOHDVVRFLDWHSURJUDP Religious Studies FRXUVHVIRUWKHFRQYHQLHQFHRISDUWWLPHZRUNLQJVWXGHQWV7KH Religious Education and Design for Leadership entire program in Business Administration may be completed in HYHQLQJFODVVHVRU:HHNHQG&ROOHJH DOWKRXJKGD\FODVVHVDUH DYDLODEOHDVZHOO DQGSRUWLRQVRIRWKHUSURJUDPVDUHRIIHUHGLQ Bachelor of Science WKHHYHQLQJDQGRQ:HHNHQGV$OOWZR\HDUSURJUDPVPD\EH Athletic Training Education completed in day classes. Biology Chemistry Criminal Justice Early Childhood Education (QYLURQPHQWDO6FLHQFH Graduation Requirements 22 A student who satisfactorily completes the graduation IRXQGXQGHUWKHYDULRXVDFDGHPLFDUHDV UHTXLUHPHQWVOLVWHGEHORZDQGZKRLVDSSURYHGIRUJUDGXDWLRQ Art E\WKHIDFXOW\DQGWUXVWHHVZLOOUHFHLYHWKH$VVRFLDWHRI$UWV Business Administration the Bachelor of Arts, or the Bachelor of Science degree. Criminal Justice Students who complete degree requirements in the summer may Graphic Design SDUWLFLSDWHLQWKHDQQXDOVSULQJFRPPHQFHPHQWDQGZLOOUHFHLYH Information Technology their diploma when requirements are completed. Students must Religious Education: Design for Leadership declare their intention to graduate by completing a graduation application in the Registration Center before January 1 prior to WKH0D\JUDGXDWLRQ2QO\VWXGHQWVZKRKDYHFRPSOHWHG Baccalaureate Degree Requirements or more credits at the end of the spring term will be allowed to (DFKVWXGHQWPXVWZRUNZLWKDQDFDGHPLFDGYLVRUWRGHYHORSD program of study which meets the following requirements: SDUWLFLSDWHLQFRPPHQFHPHQW7RUHFHLYHWKHLUGHJUHHVWXGHQWV PXVWGLVFKDUJHDOO¿QDQFLDOREOLJDWLRQVWRWKH&ROOHJHLQFOXGLQJ completing exit loan counseling, if applicable. (QUROOPHQWLQWKH)UHVKPDQ6HPLQDU )6 GXULQJWKH ¿UVWVHPHVWHUE\DOOIXOOWLPHIUHVKPDQVWXGHQWVEHORZ $IXOOWLPHVWXGHQWQRUPDOO\LVVXEMHFWWRWKHUHTXLUHPHQWVLQ WKHDJHRIZKRKDYHQRWKDGDVXFFHVVIXO college experience elsewhere. WKHFDWDORJFXUUHQWDWWKHWLPHRIHQWUDQFHSURYLGHGDGHJUHH Satisfactory completion of 120 semester credits. LVFRPSOHWHGZLWKLQ¿YHFDOHQGDU\HDUVRIHQWUDQFH)RUSDUW General Studies courses numbered below 100 WLPHVWXGHQWVWKHWLPHOLPLWLVHLJKWFDOHQGDU\HDUV+RZHYHUD student may elect to change to the requirements stated in a more do not apply. recent catalog. $FXPXODWLYHJUDGHSRLQWDYHUDJH HTXLYDOHQWWRD ³&´LQDOOZRUNXQGHUWDNHQ DVZHOODVLQWKH PDMRU¿HOG Associate of Arts Degree Completion of the general education requirements listed in this publication. Requirements &RPSOHWLRQRIWKHODVWFUHGLWVDW'H¿DQFH&ROOHJHRU (DFKVWXGHQWPXVWZRUNZLWKDQDFDGHPLFDGYLVRUWRGHYHORSD 45 of the last 60 credits, unless special exception is program of study which meets the following requirements: JLYHQ LQZULWLQJE\WKH$FDGHPLF'HDQ Completion of 26 credits in courses numbered 300 or Satisfactory completion of 60 semester credits. DERYH $FXPXODWLYHJUDGHSRLQWDYHUDJH HTXLYDOHQWWRD &RPSOHWLRQRIDPDMRU¿HOGRIVWXG\ ³&´LQDOOZRUNXQGHUWDNHQLQFOXGLQJWKHPDMRU ¿HOG $PDMRULVDFRQFHQWUDWLRQRIFRXUVHVLQRQHRUPRUHGLVFLSOLQHV Completion of the following general education consisting of a minimum of 30 credits as prescribed by the UHTXLUHPHQWV DFDGHPLFDUHD V LQYROYHG$WOHDVWFUHGLWVRIWKHPDMRUPXVW (1&RPSRVLWLRQ EHFRPSOHWHGDW'H¿DQFH&ROOHJHXQOHVVVSHFLDOH[FHSWLRQLV &$)XQGDPHQWDOVRI2UDO&RPPXQLFDWLRQ recommended in writing by faculty in the academic area and 62/LIHLQ6RFLHW\ DSSURYHGE\WKH$FDGHPLF'HDQ 16(DUWKLQWKH&RVPRV RU 16'HYHORSPHQWRI/LIHRQ(DUWK )RUDPDMRU¿HOGVWXGHQWVPD\VHOHFWHLWKHUDVLQJOHGLVFLSOLQH $+*OREDO&LYLOL]DWLRQ, RU PDMRU VXFKDV+LVWRU\ RUDQDUHDPDMRUZKLFKLQFOXGHVVHYHUDO $+*OREDO&LYLOL]DWLRQ,, GLVFLSOLQHV VXFKDVQDWXUDOVFLHQFHV $FDGHPLFPDMRUVDQG 5/$SSURDFKHVWR5HOLJLRQ RU WKHUHTXLUHPHQWVIRUWKHLUFRPSOHWLRQDUHVSHFL¿HGLQWKLV 5/+HEUHZ%LEOH SXEOLFDWLRQ$QXPEHURIDUHDPDMRUVDUHDOVRGHVFULEHG2WKHU $5$UW$SSUHFLDWLRQ RU DUHDPDMRUVPD\EHGHYHORSHGDVWKH&ROOHJHVHHVDQHHGIRU $5$UW+LVWRU\, RU WKHPRUVWXGHQWVPD\GHVLJQDPDMRUWKDWFORVHO\UHÀHFWVWKHLU $5$UW+LVWRU\,, RU interests and goals. &$3HUIRUPLQJ$UWV 3()LWQHVVIRU/LIH 6WXGHQWVPXVWGHFODUHDPDMRUQRODWHUWKDQWKHHQGRIWKH 7RWDOKRXUV VRSKRPRUH\HDUDQGLWLVVRPHWLPHVDGYLVDEOHWRGHFODUHDPDMRU &RPSOHWLRQRIFUHGLWVDW'H¿DQFH&ROOHJH LQWKHIUHVKPDQ\HDU7KHGHFODUDWLRQLV¿OHGLQWKH5HJLVWUDWLRQ &RPSOHWLRQRIWKHVSHFL¿FFRXUVHVUHTXLUHGIRUWKH &HQWHUDQGLQPRVWFDVHVVWXGHQWVDUHWKHQDVVLJQHGDQDGYLVRULQ PDMRU ¿HOGRIVWXG\ WKHPDMRU¿HOG 6SHFL¿FLQIRUPDWLRQRQDVVRFLDWHRIDUWVGHJUHHSURJUDPVFDQEH Graduation Requirements 23 B. NS 200 Earth in the Cosmos and one biological science Students may wish to seek a minor in an academic discipline. A course. minor is a concentration of courses in one discipline consisting of a minimum of 18 credits as prescribed by the academic area. &16'HYHORSPHQWRI/LIHRQ(DUWKDQGRQHSK\VLFDO science course, selected from Chemistry, Geology or Physics Second Baccalaureate Degrees 6WXGHQWVPD\HDUQDVHFRQGEDFFDODXUHDWHGHJUHHIURP'H¿DQFH 3K\VLFDO(GXFDWLRQDQG+HDOWKPDMRUVZLWK,QWURGXFWLRQWR Biology in High School may take BI 235 and BI 236 Human &ROOHJH,IWKH¿UVWGHJUHHZDVHDUQHGIURP'H¿DQFH&ROOHJH the student must meet the following requirements to qualify for a Anatomy and Physiology I and II to satisfy this requirement. VHFRQGGHJUHH FRPSOHWHDPLQLPXPRIVHPHVWHUKRXUV :HHNHQG&ROOHJHVWXGHQWVPD\WDNH%, DQG3+ WRIXO¿OO this requirement RIWKHVHLQUHVLGHQFHLQDGGLWLRQWRWKH¿UVWGHJUHHUHTXLUHPHQWV IXO¿OOUHTXLUHPHQWVIRUDPDMRULQDGLVFLSOLQHGLIIHUHQW IV. Social Science: (6hours) IURPWKH¿UVWGHJUHH IRUH[DPSOHDVWXGHQWFDQQRWUHFHLYHD bachelor of science degree in accounting and a bachelor of arts in Two courses are required. Students must take: PDQDJHPHQW DQG PXVWPHHWDOOUHTXLUHPHQWVLQIRUFHDWWKH 62/LIHLQ6RFLHW\ time of the student’s application for the second degree. and one course from the following list of options: 3< ,QWURGXFWLRQWR3V\FKRORJ\ ,IWKH¿UVWGHJUHHZDVQRWHDUQHGIURP'H¿DQFH&ROOHJHWKH (&0LFURHFRQRPLFV VWXGHQWPXVWIXO¿OOUHTXLUHPHQWVDVSXEOLVKHGLQWKLVFDWDORJ (&0DFURHFRQRPLFV under Baccalaureate Degree Requirements. 62&XOWXUDO'LYHUVLW\ V. Sport Science: (2 hours) Baccalaureate General Education 3( )LWQHVVIRU/LIH Requirements VI. Freshman Seminar (3hours) The following courses are required of all students in the Bachelor )6)UHVKPDQ6HPLQDU of Arts and Bachelor of Science degree programs. 5HTXLUHGGXULQJWKH¿UVWVHPHVWHURIHQUROOPHQWRIDOOIXOOWLPH IUHVKPHQEHORZWKHDJHRIZKRKDYHQRWKDGDVXFFHVVIXO I. Communication Skills: (6 hours) college experience elsewhere. (1&RPSRVLWLRQ Most students will be required to take EN 111 which is graded on VII. Senior Assessment in the Major Field (0-3 DQ$%&QRFUHGLWEDVLV$VWXGHQWWDNLQJ(1PXVWUHFHLYH credits) a grade of “C-” or higher to complete the writing requirement. Students are required to complete a senior capstone experience in 6WXGHQWVZLWKPDMRUZULWLQJGH¿FLHQFLHVZLOOEHUHTXLUHGWRWDNH ZKLFKWKH\GHPRQVWUDWHWKH\KDYHDWWDLQHGDVDWLVIDFWRU\OHYHORI VSHFL¿HGGHYHORSPHQWDOHGXFDWLRQFRXUVHVFRQFXUUHQWO\ZLWKRU SUR¿FLHQF\LQWKHPDMRU¿HOGDQGDUHDEOHHIIHFWLYHO\WRLQWHJUDWH prior to EN 111. and interpret their specialized knowledge. &$)XQGDPHQWDOVRI2UDO&RPPXQLFDWLRQ 9,,,3UR¿FLHQF\$UHDV FUHGLWV $)RUHLJQ/DQJXDJH II. Arts and Humanities: (15hours) 6WXGHQWVPXVWVWXG\WKHHTXLYDOHQWRIHLJKWFUHGLWVLQDVLQJOH )LYHFRXUVHVDUHUHTXLUHG IRUHLJQODQJXDJH6WXGHQWVZKRKDYHFRPSOHWHGWZR\HDUVRU $+*OREDO&LYLOL]DWLRQ, more of a single language in high school with a “C-” or higher $+*OREDO&LYLOL]DWLRQ,, ¿QDOJUDGHZLOOKDYHPHWWKHIRUHLJQODQJXDJHUHTXLUHPHQW 5/$SSURDFKHVWR5HOLJLRQ RU 3UR¿FLHQF\LQ(QJOLVKZLOOVDWLVI\WKLVUHTXLUHPHQWIRU 5/+HEUHZ%LEOH international students for whom English is a second language. $5$UW$SSUHFLDWLRQ RU $5$UW+LVWRU\, RU %0DWKHPDWLFV $5$UW+LVWRU\,, RU Students must complete MA 104 Intermediate Algebra, PY/SW &$3HUIRUPLQJ$UWV %HKDYLRUDO6WDWLVWLFVRU%$%XVLQHVV6WDWLVWLFV6SRUWV (16WRULHVDQG,PDJHVRI([SHULHQFH RU 6FLHQFHPDMRUVPD\WDNH3((YDOXDWLRQDQG0HDVXUHPHQWWR (16WRULHVDQG,PDJHVRIWKH1RQ:HVWHUQ:RUOG PHHWWKLVUHTXLUHPHQW6WXGHQWVZKRKDYHFRPSOHWHG$OJHEUD,, LQKLJKVFKRROZLWKD³&´RUKLJKHU¿QDOJUDGHZLOOKDYHPHWWKH III. Natural Science: (8 hours) College’s mathematics requirement. Students must select one of the following options $16(DUWKLQWKH&RVPRV DQG &&RPSXWHU 16 'HYHORSPHQWRI/LIHRQ(DUWK $OOVWXGHQWVPXVWDFKLHYHSUR¿FLHQF\LQFRPSXWHUXVDJHLQ Special Academic Programs 24 'H¿DQFH&ROOHJHRIIHUVVWXGHQWVDZLGHUDQJHRIVSHFLDO in the Arts and Humanities. Students who maintain a 3.25 GPA programs designed both to broaden and to deepen the college DQGDUHFRUGRISDUWLFLSDWLRQLQKRQRUVVSRQVRUHGHYHQWVPD\ experience. These programs encompass such goals as apply for designation as Carolyn M. Small Scholars. Funding preparing for a career, learning to think and act independently, IURPWKHSURJUDPPD\SURYLGHVXSSRUWIRULQFUHDVHG and exploring the world and the people in it. It is hoped that VWXGHQWWUDYHOPDWHULDOVDQGHTXLSPHQWQHFHVVDU\IRUWKH VWXGHQWVFDQ¿QGD&ROOHJHSURJUDPWKDW¿WVWKHLURZQVSHFLDO LPSOHPHQWDWLRQRIWKH+RQRUV&XUULFXOXP3URMHFWV)RUIXUWKHU requirements. If not, the College stands ready to help the details, contact the Academic Dean. LQGLYLGXDOVKDSHVXFKDSURJUDP Pre-Professional Programs On Campus Program Options 3URIHVVLRQDOVFKRROVLQVXFK¿HOGVDVODZWKHPHGLFDO The McMaster School for Advancing SURIHVVLRQVDQGWKHRORJ\UDUHO\VSHFLI\WKHXQGHUJUDGXDWHPDMRU 7KH\GRKRZHYHUUHFRPPHQGFHUWDLQFRXUVHVRIVWXG\'H¿DQFH Humanity &ROOHJHSURYLGHVVSHFLDOIDFXOW\DGYLVRUVLQHDFKRIWKHVH¿HOGVWR 7KH0F0DVWHU6FKRROIRU$GYDQFLQJ+XPDQLW\WKHQHZHVW help the student prepare wisely for professional school. DFDGHPLFXQLWRI'H¿DQFH&ROOHJHZDVIRUPHGLQWKURXJK WKHJHQHURVLW\DQGYLVLRQRIWKH0F0DVWHUIDPLO\7KHPLVVLRQ Pre-Law Studies: A student interested in law should acquire of the McMaster School is to educate students for responsible a solid educational background which includes the humanities, citizenship - to produce committed global citizens and leaders history, the social sciences, mathematics, and language ZKRZLOOXQGHUVWDQGWKHLPSRUWDQFHRILQGLYLGXDOOLEHUW\LQ VNLOOV(QJOLVKVWXGLHVDUHRISURYHQVSHFLDOLPSRUWDQFH$ LPSURYLQJWKHKXPDQFRQGLWLRQZRUOGZLGHDQGZKRZLOOWDNHDQ recommended program of study for a pre-law student would DFWLYHUROHLQDGGUHVVLQJWKHVHLVVXHVZKDWHYHUSURIHVVLRQVWKH\ include courses in literature, speech, a year of accounting, a PD\FKRRVH7KH6FKRROZLOOFULWLFDOO\LQYHVWLJDWHWKHIDFWRUV FRXUVHLQORJLFDQGDGYDQFHGFRXUVHVLQFRPSRVLWLRQRUFUHDWLYH that contribute to human suffering and impede human progress. writing. 7KH0F0DVWHU6FKRROZLOOIXO¿OOLWVPLVVLRQWKURXJKVHYHUDO 0RVWODZVFKRROVUHTXLUHWKH/6$7 /DZ6FKRRO$GPLVVLRQ program elements, including the McMaster Scholars, McMaster 7HVW )RUDGGLWLRQDOLQIRUPDWLRQWKHVWXGHQWVKRXOGFRQVXOWWKH )HOORZV'LVWLQJXLVKHG9LVLWLQJ6FKRODULQWHUQDWLRQDOVHUYLFH current pre-law handbook, published in October and prepared by SURMHFWVV\PSRVLDSXEOLFDWLRQVSURJUDPGHYHORSPHQWVXSSRUW the Law School Admission Test Council and The Association of DQGFXUULFXOXPGHYHORSPHQWVXSSRUW $PHULFDQ/DZ6FKRROV,WLVDYDLODEOHLQWKH2I¿FHRI&DUHHU DQG6WXGHQW6HUYLFHV Each year the McMaster School will sponsor up to ten undergrad- uate students who are selected for the honor based on academic Pre-Ministry Studies:7REHFRPHDQRUGDLQHGPLQLVWHULQPDMRU SURPLVHDQGWKHLUFRPPLWPHQWWRLPSURYLQJWKHKXPDQFRQGLWLRQ Christian denominations often requires a master degree. Students WKURXJKWKHLURZQVHUYDQWOHDGHUVKLS0F0DVWHU6FKRODUVZRUN ZKRVHHNHYHQWXDOO\WRHQWHUDPDVWHUSURJUDPDWDWKHRORJLFDO FORVHO\ZLWK0F0DVWHU)HOORZVRQSURMHFWVDQG VHPLQDU\PD\SXUVXHDQXQGHUJUDGXDWHPDMRUEXWWKH\VKRXOG SUHVHQWDWLRQVDQGGHVLJQWKHLURZQRULJLQDOUHVHDUFKSURMHFWVWR KDYHDEURDGHGXFDWLRQDOEDFNJURXQGLQDUWVDQGKXPDQLWLHV EHFRQGXFWHGGXULQJDQLQWHUQDWLRQDO6HUYLFH/HDUQLQJWULS social sciences, and natural sciences. Select courses in Biblical studies, theology, world religions, and Christian Education 0F0DVWHU)HOORZVDUH'H¿DQFH&ROOHJHIDFXOW\DQGVWDIIZKR are especially recommended. Some courses in business, KDYHGHPRQVWUDWHGWKHLUFRPPLWPHQWWRVHUYDQWOHDGHUVKLS FRPPXQLFDWLRQDQGHGXFDWLRQDOVRPD\SURYLGHSUDFWLFDO )HOORZVUHFHLYHUHDVVLJQHGWLPHDQG¿QDQFLDOVXSSRUWIRUWKHLU NQRZOHGJHWKDWLVXVHIXOIRUPLQLVWU\:HHQFRXUDJHVLJQL¿FDQW UHVHDUFKDQGSURJUDPGHYHORSPHQWWRKHOSDGYDQFHKXPDQLW\ H[SHULHQFHSURYLGLQJVHUYLFHWRRWKHUV0DVWHU\RIDIRUHLJQ WKURXJKWKHLUGLVFLSOLQHV7KH\ZLOODOVRZRUNZLWKDQGVXSHUYLVH language is often recommended or required by seminaries, as is the McMaster Scholars. the Graduate Record Exam. Because admission requirements YDU\VWXGHQWVVKRXOGFRQWDFWVFKRROVRILQWHUHVWHDUO\LQWKHLU 7KH0F0DVWHU6FKRRODOVRHQULFKHVWKH'H¿DQFH&ROOHJHFRP- undergraduate program. They also should consult with a faculty PXQLW\E\SURYLGLQJIXQGVWRSXUFKDVHODERUDWRU\DQGUHVHDUFK member in religious studies and the Campus Minister, as well as HTXLSPHQWDQGWKURXJKIXQGVLQDFDGHPLFGLYLVLRQVDQGLQWKH WKH2I¿FHRI&DUHHUDQG6WXGHQW$VVLVWDQFH general fund for supporting the efforts of faculty and staff to LPSURYHWKHKXPDQFRQGLWLRQZRUOGZLGH The pre-nursing student will require also one or two years of VWXG\DW7KH'H¿DQFH&ROOHJHDQGWKHQWUDQVIHUWRDQDFFUHGLWHG nursing school to complete the registered nursing degree. Each Honors Program VWXGHQW¶VSUHQXUVLQJSURJUDPDW'H¿DQFHLVSODQQHGLQGLYLGXDOO\ 7KH'H¿DQFH&ROOHJH+RQRUV3URJUDPSURYLGHVDQRSSRUWXQLW\ to meet the requirements of the nursing school the student wants IRU'H¿DQFHVWXGHQWVWRSDUWLFLSDWHLQDQKRQRUVFXUULFXOXPEDVHG to attend. Special Academic Programs 25 Non-Traditional Credit The pre-veterinaryVWXGHQWVKRXOGPDMRULQ(QYLURQPHQWDO A maximum of 30 credits of non-traditional credit may be earned 6FLHQFH7KHPDMRUVKRXOGLQFOXGHFKHPLVWU\ JHQHUDORUJDQLF WRZDUGJUDGXDWLRQWKURXJK GLVWDQFHHGXFDWLRQFRXUVHV ELRFKHPLVWU\DQGTXDQWLWDWLYHDQDO\VLV ELRORJ\ ERWDQ\ DUPHGIRUFHVVHUYLFH RU DVVHVVPHQWRISULRUOHDUQLQJ LQFOXG- ]RRORJ\JHQHWLFVEDFWHULRORJ\FRPSDUDWLYHDQDWRP\DQG LQJWHVWLQJDQGSRUWIROLRGHYHORSPHQW 1RQWUDGLWLRQDO&UHGLW SK\VLRORJ\ D\HDURISK\VLFVDQGHOHFWLYHVDVUHFRPPHQGHGE\ PD\EHFRXQWHGWRZDUGWKHPDMRURQO\ZLWKDSSURYDORIWKHDS- SUHIHUUHGYHWHULQDU\VFKRROV)DUPH[SHULHQFHZLWKOLYHVWRFNLV SURSULDWHGLYLVLRQ GHVLUDEOHDVLVZRUNLQDQLPDOFOLQLFVRUYHWHULQDU\KRVSLWDOV Distance Education course catalogs are available in the The pre-dentistry and pre-optometry student should also Registration Center for perusal. Students must have the PDMRULQ(QYLURQPHQWDO6FLHQFH7KHPDMRUVVKRXOGLQFOXGH approval of the registrar to take Distance Education courses if FKHPLVWU\ JHQHUDORUJDQLFELRFKHPLVWU\DQGTXDQWLWDWLYH transfer credit is desired. The Division Chair must also approve DQDO\VLV ELRORJ\ ERWDQ\]RRORJ\JHQHWLFVEDFWHULRORJ\DQG courses that will apply to the majors. KXPDQDQDWRP\DQGSK\VLRORJ\ D\HDURISK\VLFVDQGHOHFWLYHV as recommend by preferred dental and optometry schools. Students wishing credit for armed forces service must present Applicants to these schools must take the admission tests. The documentation for evaluation by the Registrar. tests are usually taken in the fall or spring of the year before expected enrollment in dental school. Prior learning is learning that has resulted from work experiences and training since high school. This learning A typical pre-medical program may be the same as a pre-dental may be demonstrated by (1) testing, or by (2) portfolio SURJUDP+RZHYHUPDQ\PHGLFDOVFKRROVDUHVHHNLQJDYDULHW\ development. of backgrounds in their students and the pre-medical student LVHQFRXUDJHGWRGHYHORSYHUEDOVNLOOVE\HOHFWLQJVSHHFKDQG Testing includes the options of both CLEP and DANTES tests. literature courses. The Medical College Admissions Test is A list of the tests available and the passing scores required UHTXLUHGDQGVKRXOGEHWDNHQLQWKHVSULQJRIWKHMXQLRU\HDURU (as recommended by the American Council on Education) are the fall of the senior year. available in the Offices of Career and Student Assistance, the Center for Adult Programs, and the Registrar. In addition to the Pre-Medical Studies:'H¿DQFH&ROOHJHRIIHUVWKHUHTXLUHG cost of the test, there is a $50 charge for each credit hour to be programs for admission to regular medical colleges, osteopathic added to the student’s transcript. medical colleges and chiropractic medical colleges. Further information can be obtained from the Natural Science faculty. A maximum of 13 credits may be earned by Portfolio Development. Elective credit is limited to 4 credits and an Advanced Placement Credits additional 9 credits may be earned for specific courses in the $GYDQFHG3ODFHPHQW $3 LVDSURJUDPGHVLJQHGWRUHFRJQL]H curriculum. Each division has identified those courses in the VWXGHQWVZKRWDNHFROOHJHOHYHOFRXUVHVLQVHFRQGDU\VFKRRO curriculum for which a student may demonstrate knowledge 'H¿DQFH&ROOHJHGRHVDFFHSW$3FUHGLWVEDVHGXSRQVFRUHVSUH- by portfolio development. sented of three or higher. 7KHIDFXOW\KDYHHVWDEOLVKHGWKHIROORZLQJSROLFLHVDQGSURFH- GXUHVIRU3RUWIROLR'HYHORSPHQW Transfer Credit 7KHVWXGHQWPXVWKDYHEHHQDGPLWWHGDVDGHJUHHVHHNLQJ Associate degree graduates of regionally accredited two-year col- VWXGHQWDW'H¿DQFH&ROOHJHDQGFRPSOHWHGDFRXUVHSULRUWR leges may be accepted with credit granted for all courses included HQUROOPHQWLQWKHSRUWIROLRGHYHORSPHQWFRXUVH LQWKHGHJUHHWRDPD[LPXPRIFUHGLWVQRWH[FHHGLQJWKHYDOXH ,ID&/(3RU'$17(6WHVWLVDYDLODEOHIRUDFRXUVHLQZKLFK RIWKHGHJUHH*UDGXDWHVRIRWKHUWZR\HDUVFKRROVPD\UHFHLYH credit is desired, the test must be taken. The portfolio is not an - XSWRFUHGLWVQRWH[FHHGLQJWKHYDOXHRIWKHGHJUHHSURYLG option. LQJWKHPDMRUSURJUDPLVFRPSDWLEOHZLWKWKH&ROOHJH¶VDFDGHPLF 3. The student should consult the division chair regarding program. portfolio development as the first step in the assessment process. More than one portfolio may be required if credit is &RXUVHZRUNFUHGLWHYDOXDWLRQZLOOEHSHUIRUPHGE\WKH5HJLVWUDU desired for more than one course. Credit will be granted for courses completed that are compatible 4. All candidates seeking credit for prior learning must register with the College’s academic program and with grades of a C or IRUDRQHKRXU3RUWIROLR'HYHORSPHQW&RXUVH *6 higher. Transfer students shall satisfy the general education and ZKLFK ZLOODVVLVWLQSRUWIROLRGHYHORSPHQW academic concentration requirements including those learning ex- D7RUHFHLYHFUHGLWIRUWKHFRXUVHDSRUWIROLRPXVWEH SHULHQFHVZKLFKDUHXQLTXHWR'H¿DQFH&ROOHJH$GHWDLOHGJXLGH completed by the end of the semester in which the WRWUDQVIHUFUHGLWSROLFLHVLVDYDLODEOHIURPWKH5HJLVWUDU Special Academic Programs 26 course is taken. Students may initiate, plan and coordinate courses on topics b. The course will be graded pass/fail. ZKLFKLQWHUHVWWKHPDQGVHUYHYDOLGHGXFDWLRQDOSXUSRVHV c. The portfolio must be well written and the student )DFXOW\PHPEHUVZLOOEHDYDLODEOHDVUHVRXUFHSHRSOHDQGWKH PXVWXQGHUVWDQGWKHSURFHVVRISRUWIROLRGHYHORSPHQW FRXUVHVKRXOGEHGHYHORSHGLQFRRSHUDWLRQZLWKDIDFXOW\DGYLVRU to pass the course. Students planning such courses must make application through d. The course will be offered in the spring semester. WKH$FDGHPLF'HDQ¶VRI¿FHDQGVHFXUHWKHDSSURYDORIWKHIDFXOW\ Assessment Procedures DGYLVRU)LQDODSSURYDOLVLQWKHKDQGVRIWKH$FDGHPLF$IIDLUV 7RUHFHLYHFUHGLWIRUDFRXUVHLQWKHFXUULFXOXPWKH Committee. A copy of the course outline must be submitted to SRUWIROLRPXVWGHPRQVWUDWHWKDWWKHOHDUQLQJREMHFWLYHV the committee one week before a meeting at which committee RIWKHFRXUVHKDYHEHHQPHW7RUHFHLYHHOHFWLYHFUHGLW members decide whether the course should be offered for credit. for past work experience, the portfolio must demonstrate WKDWFROOHJHOHYHOOHDUQLQJKDVRFFXUUHGRQWKHMRE Self-Designed Major Programs Prior learning, not prior experience, is the basis 'H¿DQFH&ROOHJH¶VRUJDQL]DWLRQRIWUDGLWLRQDODFDGHPLF for credit awarded. disciplines into “umbrella” areas makes it easier for students 7KHGLYLVLRQKHDGZLOODSSRLQWDIDFXOW\PHPEHUIURP WRFUHDWHDQLQGLYLGXDOPDMRU8QGHUWKHXPEUHOODRI WKHGLYLVLRQZKRKDVH[SHULHQFHLQWKDWDUHDWR natural science, for instance, students might concentrate on read and assess the portfolio. The faculty HQYLURQPHQWDOVWXGLHVRUFRQVHUYDWLRQ6WXGHQWVDUHDOVRIUHHWR PHPEHUDQGWKH GLYLVLRQKHDGPXVW GHVLJQDPDMRUZKLFKFURVVHVDFDGHPLFDUHDV DSSURYHWKHFUHGLWWREHDZDUGHG 3. The faculty member will read the portfolio by the end of 6WXGHQWVLQWHUHVWHGLQDVHOIGHVLJQHGPDMRUPD\EHJLQSODQQLQJ the spring semester in which the portfolio was it at the end of their freshman year, working closely with their completed. DFDGHPLFDGYLVRUVDQGVHFXULQJWKHDSSURYDORIWKH$FDGHPLF ,QDGGLWLRQWRWKHWXLWLRQIRUWKH3RUWIROLR&RXUVHD Dean or the Academic Affairs Committee. Such a program assessment fee will be charged for each portfolio FRXOGLQFOXGHDFRPELQDWLRQRIRQFDPSXVFRXUVHVFRRSHUDWLYH VXEPLWWHGDQGDIHHZLOOEHFKDUJHGIRUHDFKFUHGLW HGXFDWLRQLQWHUQVKLSVRU¿HOGH[SHULHQFHLQGHSHQGHQWVWXG\RU hour to be added to the student’s transcript. ZRUNDWRWKHULQVWLWXWLRQV7KLVPDMRUPXVWEHVXEPLWWHGWRWKH :KHQDOOIHHVKDYHEHHQSDLGDQGXSRQ Registrar by the beginning of the second semester of the student’s recommendation of credit by the faculty member and MXQLRU\HDU GLYLVLRQKHDGWKHFRXUVHWLWOH V DQGFUHGLW V ZLOOEH entered on the student’s transcript. No grade is recorded. Off-campus Academic Programs 6. The portfolio will be retained by the College. Service Learning 'H¿DQFH&ROOHJHKDVDXQLTXHFRXUVHHPEHGGHGVHUYLFHOHDUQLQJ Independent Study PRGHOLQZKLFKVHOHFWHGFRXUVHVLQFOXGHDFRPPXQLW\VHUYLFH ,QGHSHQGHQWVWXG\PD\EHHLWKHUSURMHFWRUUHVHDUFKRULHQWHG FRPSRQHQW$QLQWURGXFWLRQWRVHUYLFHOHDUQLQJLVSUHVHQWHGLQ The topics for independent study are not usually part of the )UHVKPDQ6HPLQDU )6 DQGLVFRQWLQXHGLQ/LIHLQ6RFLHW\ FXUULFXOXPEXWUHÀHFWDVWXGHQW¶VVSHFLDOLQWHUHVW RUWKH\WDNHD 626: 0RVWRIWKHPDMRUVSURYLGHWZRRUWKUHHXSSHU VWXGHQWIXUWKHULQWRDVXEMHFWWKDQUHJXODUFRXUVHZRUNDOORZV OHYHOFRXUVHVZLWKVHUYLFHRSSRUWXQLWLHVDVZHOODVDVHQLRU A student in independent study will work closely with a faculty capstone experience. PHPEHULQSODQQLQJH[HFXWLQJDQGHYDOXDWLQJWKHSURJUDP Independent study forms must be submitted to the Registration 6HUYLFHOHDUQLQJLVDPHWKRGRIWHDFKLQJDQGH[SHULHQWLDOOHDUQLQJ Center within two weeks after the beginning of the semester. that emphasizes a hands-on approach to addressing college and FRPPXQLW\FRQFHUQVWKURXJKFLYLFHQJDJHPHQWDQGYROXQWHHU VHUYLFH7KLVDSSURDFKSURYLGHVVWXGHQWVZLWKDQRSSRUWXQLW\WR Readings apply the facts, concepts, and principles taught in the traditional 6WXGHQWVHQJDJHLQLQGLYLGXDOUHDGLQJSURJUDPVIRUDYDULHW\ classroom setting to real community needs and concerns. RIUHDVRQV WRSUHSDUHIRUDODWHULQGHSHQGHQWUHVHDUFKSURMHFW /LNHZLVHWKHDFDGHPLFDUHDHQULFKHVWKHVHUYLFHH[SHULHQFHE\ WR¿OODYRLGLQEDFNJURXQGNQRZOHGJHRUVLPSO\WRUHDGWKH UDLVLQJTXHVWLRQVDERXWWKHVHLVVXHVDQGSURYLGLQJDIRUXPIRU OLWHUDWXUHRQDVXEMHFWIRULWVRZQYDOXH,QDOOFDVHVWKHSURJUDP GLVFXVVLRQDQGUHÀHFWLRQ$VDQHGXFDWLRQDOSKLORVRSK\VHUYLFH LVGLUHFWHGWRZDUGVRPHVSHFL¿FJRDODQGSXUSRVH6WXGHQWV OHDUQLQJIRVWHUVDEDODQFHEHWZHHQOHDUQLQJJRDOVDQGVHUYLFH who wish to undertake a reading program for credit should make RXWFRPHVWKDWFDQEHDFKLHYHGRQO\WKURXJKLQWHJUDWLRQ,W DSSOLFDWLRQWKURXJKDIDFXOW\VXSHUYLVRU SUHSDUHVVWXGHQWVWREHLQWHUDFWLYHDQGUHVSRQVLEOHSDUWLFLSDQWVLQ both their professions and the life of their communities. Student-Designed Courses Special Academic Programs 27 Cooperative Education the principles and techniques learned to a practical situation. &RRSHUDWLYH(GXFDWLRQRIIHUVSDLGHPSOR\PHQWWRHQKDQFH Students are expected to analyze critically the situation and RSWLPXPLQGLYLGXDODGMXVWPHQWWRZDUGVHOIUHDOL]DWLRQDQGFDUHHU WRHYDOXDWHWKHH[SHULHQFHLQOLJKWRIWKHLUDFDGHPLFZRUNDQG GHYHORSPHQWE\LQWHJUDWLQJFODVVURRPVWXG\ZLWKSODQQHGDQG career plans. Students must make arrangements with a faculty VXSHUYLVHGH[SHULHQFHLQFDUHHUDFWLYLWLHVRXWVLGHRIWKHIRUPDO VXSHUYLVRUEHIRUHWDNLQJSDUWLQD¿HOGH[SHULHQFH FODVVURRPHQYLURQPHQW/HDUQLQJGRHVQRWFRQ¿QHLWVHOIWR PHGLFLQHSUHGHQWLVWU\SUHRSWRPHWU\SUHYHWHULQDU\VFLHQFH DWWHPSWVWRDFKLHYHDFDGHPLFPDVWHU\7KHSRVLWLYHGHYHORSPHQW DQGSUHQXUVLQJ$VWXGHQWLQDQ\RIWKHVH¿HOGVLVXUJHGWRXVH RIDVWXGHQW¶VDWWLWXGHVLQWHUHVWVYDOXHVDQGPRWLYHVDUH D6XPPHU7HUPIRU¿HOGH[SHULHQFHVLQKRVSLWDOVDQGFOLQLFVWR HTXDOO\GHSHQGHQWXSRQWKLVOHDUQLQJ&RRSHUDWLYH(GXFDWLRQ JDLQ¿UVWKDQGH[SHULHQFHZLWKSUDFWLFLQJSURIHVVLRQDOV LVFRRUGLQDWHGE\WKH2I¿FHRI&DUHHUDQG6WXGHQW$VVLVWDQFH located in Hubbard Hall. Study Abroad 7KH0F0DVWHU6FKRROIRU$GYDQFLQJ+XPDQLW\VXSHUYLVHVVKRUW &RRSHUDWLYH(GXFDWLRQLVDYDLODEOHLQDOOPDMRU¿HOGVWRVWXGHQWV WHUPWUDYHODQGVWXG\DEURDGRSSRUWXQLWLHVIRU'H¿DQFH&ROOHJH ZKRKDYHUHDFKHGMXQLRUVWDWXVDQGDUHLQJRRGDFDGHPLF students. Students interested in participating in the program standing. Interested students should consult with their academic VKRXOGFRQWDFWWKH'HDQRIWKH0F0DVWHU6FKRROIRU$GYDQFLQJ DGYLVRUDQGWKHFRRUGLQDWRURIFRRSHUDWLYHHGXFDWLRQWRZRUNRXW Humanity. DQLQGLYLGXDOMRESODFHPHQWZKLFKZLOOUHÀHFWFDUHHULQWHUHVWV DQGPDNHDVLJQL¿FDQWFRQWULEXWLRQWRWKHPDMRU¿HOGRIVWXG\ Independent Study projects that may incorporate travel and 7KHVWXGHQWPXVWZRUNWKURXJKWKH2I¿FHRI&DUHHUDQG6WXGHQW study abroad are also available to students chosen as McMaster $VVLVWDQFHIRUSODFHPHQWHGXFDWLRQDORXWFRPHVDQGVXSHUYLVLRQ Scholars. Details about the McMaster Scholars program are procedure and assessment. For each credit hour earned, the available from the Dean of the McMaster School. VWXGHQWPXVWZRUNKRXUVRQWKHMRE In addition, Defiance College cooperates with the Brethren Colleges Abroad Program (BCA) that offers programs in Athens, The student pays only the regular semester-hour rate for co- Greece; Barcelona, Spain; Cheltenham, and Oxford, England; RSFUHGLWV7KLVIHHFRYHUVVXFKVHUYLFHVDVMRESODFHPHQW Dalian, China; Marburg, Germany; Zuio, Ecuador; Sapporo, HYDOXDWLRQUHFRUGNHHSLQJRQWKHMREFRXQVHOLQJDQGFUHGLWLQJ Japan; Strasbourg and Nancy, France; and Zalapa, Mexico. Defiance College Students register for the semester as usual Internships which may cover the tuition costs for the semester abroad. $QLQWHUQVKLSLVDQXQSDLGRQWKHMREOHDUQLQJH[SHULHQFHUHODWHG However, recipients of large College academic scholarships WRWKHVWXGHQW¶VPDMRU¿HOGRIVWXG\IRUZKLFKFUHGLWLVUHFHLYHG may be responsible for a portion of the tuition costs. Financial EDVHGRQTXDOLW\RISHUIRUPDQFH,QWHUQVKLSVJHQHUDOO\FRYHU arrangements are reviewed in each individual case. The shorter time spans than co-op work periods. The student will be student is responsible for all extra costs, including room, board, VXSHUYLVHGE\ERWKDIDFXOW\VSRQVRUDQGDTXDOL¿HGSHUVRQDWWKH and transportation. The additional costs vary according to site place of work. An Experiential Learning form may be obtained and fluctuation of dollar values, but usually range from $3000 in the Registration Center and must be returned to the Center - $5000. Students may also participate in other study abroad no later than two weeks after the beginning of the semester. All programs with which the College has an official relationship. students seeking teacher licensure must complete a 15-week Information on these programs is located in the McMaster LQWHUQVKLSZLWKFROOHJHVXSHUYLVLRQDQGVSHFL¿HGPHWKRGVRI School office. assessment. Curricula in the BCA programs vary. It is the student’s Field Experience responsibility to work with the Registrar, Academic Dean and major advisor to ensure that all credits earned will be applied $¿HOGH[SHULHQFHDIIRUGVVWXGHQWVDQRSSRUWXQLW\WRHQJDJH to the 120 hours required for graduation. Students must also LQQRQFODVVURRPOHDUQLQJXQGHUWKHVXSHUYLVLRQRIDTXDOL¿HG consult the Registrar before the semester abroad to review the person. Field experience differs from an internship in that it does impact on general education and major requirements. QRWQHFHVVDULO\WDNHSODFHZLWKLQWKHFRQWH[WRIDMREDQGVWXGHQWV FDQEHREVHUYHUVUDWKHUWKDQZRUNHUV$Q([SHULHQWLDO/HDUQLQJ Students apply to the BCA programs directly either through form may be obtained in the Registration Center and must be Brethren Colleges Abroad or other available study abroad returned to the Center no later than two weeks after the beginning programs. Acceptance into these programs is not determined of the semester. by Defiance College. Further information is available from the The program is designed to introduce students to a professional Dean of the McMaster School for Advancing Humanity. area before enrollment in professional courses or to enable VWXGHQWVZKRKDYHFRPSOHWHGVRPHSURIHVVLRQDOFRXUVHVWRDSSO\ Academic Policies 28 Class Standing instructors as soon as possible after returning if the student has The class standing of a student is determined as follows: not been able to contact them while away. Acceptance of the Freshmen - 0 to 23 credits completed H[FXVHLVDWWKHGLVFUHWLRQRIWKHLQGLYLGXDOLQVWUXFWRU Sophomore - 24 to 53 credits completed Junior - 54 to 83 credits completed 7KH&ROOHJHGRHVQRWKDYHD³FXW´V\VWHPRUDVWDQGDUGVHWRI Senior - 84 or more credits completed penalties for unexcused absences. Both are left to the discretion RIWKHLQGLYLGXDOLQVWUXFWRUDQGLWLVXSWRWKHVWXGHQWWROHDUQ instructors’ policies. An instructor has the right to withdraw Course Load DVWXGHQWIRUH[FHVVLYHDEVHQFHVDIWHUFRQVXOWDWLRQZLWKWKH Normally, students carry a course load of 15 credits each regular Academic Dean or the Dean of Students. term. But a student may carry as few as 12 credits in a regular WHUPDQGVWLOOUHPDLQHQUROOHGIXOOWLPH VRPHEHJLQQLQJVWXGHQWV DUHDGYLVHGWRWDNHQRPRUHWKDQFUHGLWVLQWKHLU¿UVWWHUP Registration Students whose academic skills are not strong upon entering the New students will register for courses as part of the orientation College should be prepared for the possibility that graduation process. Returning students are required to schedule classes for may require more than four years. the next term or year at the announced time. Those who fail to schedule and complete the registration payment process and +RZHYHUVHPHVWHUFUHGLWVDUHWKHPLQLPXPSHUPLWWHGIRU VXEPLWUHTXHVWHG¿QDQFLDODLGGRFXPHQWVLIDSSOLFDEOHRQWKH full-time enrollment. A resident undergraduate student may not days indicated by the College calendar may be charged a late register for fewer than 12 credits per regular term nor reduce the registration fee. FRXUVHORDGEHORZWKLVOHYHOZLWKRXWSHUPLVVLRQRIWKH'HDQRI Students and the Registrar. Any undergraduate student who /DWHUHJLVWUDWLRQRIIXOOWLPHVWXGHQWVUHTXLUHVDGYDQFH enrolls for 12 semester hours or more in any fall or spring term permission from the Registrar and will be allowed only during will be charged the full-time tuition fee. This policy applies WKH¿UVWWKUHHGD\VRIFODVVHV to any combination of undergraduate or graduate courses. Under- graduates receiving financial aid as a full-time student 6WXGHQWVPD\QRWUHJLVWHUIRUORZHUOHYHOFRXUVHVLQDUHDVZKHUH must be enrolled in at least 12 hours of undergraduate course WKH\KDYHSUHYLRXVO\WDNHQPRUHDGYDQFHGZRUN work. Schedule Changes and Withdrawals Auditing Courses 6WXGHQWVPD\FKDQJHDFODVVVFKHGXOHGXULQJWKH¿UVW¿YHGD\V Students should register for a course as an audit if they want to RIFODVVHVLQDUHJXODUWHUPRUWKH¿UVWWZRGD\VRIDVXPPHU REWDLQWKHLQIRUPDWLRQIURPWKHFRXUVHEXWGRQRWZDQWWRUHFHLYH session. After that, the student may withdraw from a class but credit. An audit student is not required to hand in work or take may not add one, bearing in mind that reduction of the course WHVWV:KHQFODVVVL]HLVOLPLWHGIXOOIHHVWXGHQWVKDYHSULRULW\ load below 12 credits in a regular term requires the permission of ,QGLYLGXDOPXVLFLQVWUXFWLRQPD\QRWEHDXGLWHG the Dean of Student Life and the Registrar. $VWXGHQWZKRZLWKGUDZVIURPDZHHNFRXUVHDIWHUWKH¿UVW Class Attendance week but before the end of the ninth week will automatically A student is expected to attend all classes, as well as any special UHFHLYHDJUDGHRI³:´7KHGHDGOLQHIRUDQHLJKWZHHNFRXUVH FRQIHUHQFHVPHHWLQJVDQG¿HOGWULSVWKDWWKHLQVWUXFWRUPD\ LVWKHHQGRIWKH¿IWKZHHNDQGIRUD¿YHZHHNFRXUVHWKHHQG request. The College has adopted the following policies on of the third week. After these deadlines, the grade will be “WF” student absences: XQOHVVWKHLQVWUXFWRUYLHZVWKHFLUFXPVWDQFHVDVH[WHQXDWLQJDQG JLYHVZULWWHQSHUPLVVLRQIRUWKHJUDGHWREH³:´ ,IWKHVWXGHQWNQRZVLQDGYDQFHRIDQDEVHQFHWKHLQVWUXFWRUV VKRXOGEHQRWL¿HGEHIRUHWKHDEVHQFHDQGDUUDQJHPHQWVVKRXOG $VWXGHQWPD\UHTXHVWZLWKGUDZDOIURP'H¿DQFH&ROOHJHE\ be made to make up any work missed. If the student is unable FRQWDFWLQJWKH6WXGHQW'HYHORSPHQW2I¿FHLQ+XEEDUG+DOO to notify the instructors directly, the Registration Center may be A withdrawal allows the student the opportunity to reenroll QRWL¿HGDQGZLOOFRQWDFWWKHLQVWUXFWRUVIRUWKHVWXGHQW 7KLVLV DW'H¿DQFH&ROOHJHDWDODWHUGDWH7KHZLWKGUDZDOGDWHLVWKH VLPSO\DVHUYLFHUHQGHUHGE\WKH5HJLVWUDWLRQ&HQWHUDQGGRHV GDWHRIODVWDWWHQGDQFH6WXGHQWVZKRUHFHLYH¿QDQFLDODLGDQG QRWLPSO\DSSURYDO ,IWKHVWXGHQWLVJRLQJWREHDEVHQWIRUDQ choose to withdraw from the College must follow the federal H[WHQGHGSHULRG PRUHWKDQWKUHHGD\V WKH5HJLVWUDUPXVWEH refund policy according to the federal regulations. Tuition will be QRWL¿HG refunded according to the College refund policy as described in WKLV&DWDORJ7KHDGMXVWPHQWVLQFKDUJHVIRUDVWXGHQWZLWKGUDZDO ,IWKHDEVHQFHFRXOGQRWEHDQWLFLSDWHG VXFKDVLOOQHVVRUD may result in an outstanding balance on the students account GHDWKLQWKHIDPLO\ WKHVWXGHQWVKRXOGSUHVHQWDQH[FXVHWR that will be due and payable at the time of withdrawal. Failure Academic Policies 29 to follow the withdrawal policy forfeits the students right to an FUHGLWV RUIRXUFRXUVHV LQZKLFKWKH\FKRRVHWREHJUDGHG³3´ honorable dismissal or to any refund of tuition and fees paid. or “F.” One such course may be elected per term, and the course PXVWEHRXWVLGHWKHPDMRU¿HOGDQGQXPEHUHGDERYH $ course in which the entire class is graded P/F is not included in Military Active Duty the four-course allotment. Students who are members of any branch of the U.S. military UHVHUYHVRUWKH1DWLRQDO*XDUGDQGZKRDUHFDOOHGXSWRDFWLYH Students must request the P/F option before the end of the second GXW\GXULQJDQ\WHUPLQZKLFKWKH\DUHFXUUHQWO\HQUROOHGKDYH ZHHNRIFODVVHVE\¿OLQJDUHTXHVWZLWKWKH5HJLVWUDWLRQ&HQWHU WKUHHRSWLRQV ZLWKGUDZDOIURPDOOFRXUVHV WRVHHNLQFRPSOHWHV ,QVWUXFWRUVDUHQRWWROGZKLFKVWXGHQWVKDYHFKRVHQ3)JUDGLQJ RUWRWDNHDJUDGHIRUFRXUVHVWKDWDUHVXI¿FLHQWO\FRPSOHWHG 'HWDLOVRIWKHRSWLRQVDQGSURFHGXUHVDUHDYDLODEOHIURPWKH Registration Center in Serrick Campus Center. Academic Second Chance 6WXGHQWVZKRKDYHUHFHLYHGDJUDGHRI'''RU)LQD FRXUVHWDNHQDW'H¿DQFH&ROOHJHPD\KDYHWKHJUDGHUHPRYHG Grading System IURPWKHVWXGHQW VDFDGHPLFUHFRUGLIWKHVDPHFRXUVHLVUHSHDWHG 7KHIROORZLQJV\VWHPLVXVHGIRUGHWHUPLQLQJJUDGHVDQGDUULYLQJ DW'H¿DQFH&ROOHJH$FDGHPLF6HFRQG&KDQFHGRHVQRWDSSO\ DWWKHJUDGHSRLQWDYHUDJH to courses taken at other colleges. This option may be exercised A, A- ZLWKDWRWDORIFUHGLWVGXULQJWKHVWXGHQW VDFDGHPLFFDUHHUDW B+, B, B- the College. The Registration Center must be told the option is C+, C, C- desired when the student registers for the course. An Academic D+, D, D- 6HFRQG&KDQFHSHWLWLRQPXVWEH¿OHGLQWKH5HJLVWUDWLRQ&HQWHU F LQRUGHUWRKDYHWKHRULJLQDOJUDGHUHPRYHGIURPWKHUHFRUG ,,QFRPSOHWH $Q³,´QRWPDGHXSE\WKHHQGRIWKHQH[WUHJXODU WHUPEHFRPHVDQ³)´ 33DVVLQJDW³&´OHYHORUDERYH Graduate/Undergraduate Course U - Unsatisfactory Policy W - Withdrawal An undergraduate may take a graduate course for graduate credit :):LWKGUDZDOIDLOLQJ FRXQWVDVDQ³)´LQ*3$ if: $:$GPLQLVWUDWLYH:LWKGUDZDO WKHVWXGHQWKDVFRPSOHWHG VHPHVWHUKRXUV NC - No Credit D*3$RIKDVEHHQDFKLHYHG WKHVWXGHQWPHHWVWKHFRXUVHSUHUHTXLVLWHV In order to compare the standing of students, the College uses WKHLQVWUXFWRUDQGWKHSURJUDPGLUHFWRUDSSURYH DQG DSRLQWV\VWHPZKLFKDVVLJQVWKHIROORZLQJQXPHULFDOYDOXHIRU VSDFHLVDYDLODEOHLQWKHFRXUVH each hour of credit: $ $ To be eligible for federal, state, and institutional aid, any % % % undergraduate student must enroll in at least 12 hours of & & & XQGHUJUDGXDWHFRXUVHZRUNDQGREWDLQDSSURYDOWRWDNHDJUDGXDWH ' ' ' course from the appropriate graduate program coordinator. F, WF, AW - 0 points &RXUVHVLQZKLFKWKHVWXGHQWUHFHLYHVJUDGHVRI³3´³:´³8´ Academic Appeals “NC,” and “I” are not included when computing the grade point The Academic Affairs Committee rules on student complaints of DYHUDJH7RDUULYHDWWKHDYHUDJHRQHDGGVDOOWKHSRLQWVWKH unfair treatment in academic matters. The Committee can change VWXGHQWKDVHDUQHGDQGGLYLGHVWKHWRWDOE\WKHQXPEHURIFUHGLW a “D” or “F” grade to a “P” if the complaining student presents KRXUVWDNHQ7KXVDVWXGHQWZKRWDNHV¿YHFRXUVHVRIWKUHH VXI¿FLHQWO\FRQYLQFLQJHYLGHQFH6WXGHQWVVKRXOG¿UVWGLVFXVV FUHGLWVHDFKDQGUHFHLYHVDQG³$´LQDOORIWKHPKDVDFFXPXODWHG FRQFHUQVZLWKWKHLQVWUXFWRUWKHQWKHFRUUHVSRQGLQJ'LYLVLRQ JUDGHSRLQWV GLYLGHGE\WKHWRWDOQXPEHURIFUHGLWVWKLV &KDLU8QUHVROYHGFRQFHUQVPD\WKHQEHDGGUHVVHGWRWKH$FD- \LHOGVDJUDGHSRLQWDYHUDJHRI demic Dean. $Q³,´JUDGHLVJLYHQRQO\ZKHQFLUFXPVWDQFHVEH\RQGWKH VWXGHQW¶VFRQWUROSUHYHQWFRPSOHWLRQRIDFRXUVHE\WKHHQGRIWKH Grade Reports regular semester or term. $Q\FXUUHQWO\HQUROOHG'H¿DQFH&ROOHJHVWXGHQWPD\YLHZ KLVKHUPLGWHUPDQG¿QDOJUDGHVVFKHGXOHWUDQVFULSWDQGFXUUHQW Pass-Fail Option $IWHUGHFODULQJDPDMRUVWXGHQWVPD\UHJLVWHUIRUDWRWDORI Academic Policies 30 billing statement by accessing https://ZZZGH¿DQFHHGXRQHVWRS. Transcript requests The web interface may be accessed from any computer with Transcript requests must come from the student in writing. Only access to the Internet and the proper browser software. Logon WUDQVFULSWVFDUU\LQJWKH&ROOHJHVHDODUHFRQVLGHUHG³RI¿FLDO´ ZLOOUHTXLUHWKHVWXGHQW¶V'H¿DQFH&ROOHJHXVHUQDPHDQG Transcripts issued to the student for personal use will be marked password. These may be obtained from the Registration Center in “Issued to Student.” Serrick Campus Center. During the regular semester, only students who are doing Academic Probation XQVDWLVIDFWRU\ZRUN EHORZ& UHFHLYHPLGWHUPJUDGHUHSRUWV 6WXGHQWVPXVWHDUQWKHIROORZLQJPLQLPXPFXPXODWLYHJUDGH 6WXGHQWVDUHVHQWQRWL¿FDWLRQWRWKHLU'&(PDLODGGUHVVZKHQ SRLQWDYHUDJHVWRUHPDLQDERYHWKHSUREDWLRQOHYHO JUDGHVDUHDYDLODEOHWREHYLHZHGRQOLQH 1.70 after 12 credits of course work attempted 1.80 after 24 credits &RQ¿GHQWLDOLW\RI6WXGHQW5HFRUGV of course work attempted $QQXDOO\'H¿DQFH&ROOHJHZLOOLQIRUPVWXGHQWVRIWKH)DPLO\ 1.90 after 36 credits (GXFDWLRQDO5LJKWVDQG3ULYDF\$FWRI 7KLV$FWZLWK of course work attempted which the institution intends to comply fully, was designated to 2.00 after 48 credits SURWHFWWKHSULYDF\RIHGXFDWLRQUHFRUGVWRHVWDEOLVKWKHULJKWRI of course work attempted and VWXGHQWVWRLQVSHFWDQGUHYLHZWKHLUHGXFDWLRQDOUHFRUGVDQGWR subsequent work. SURYLGHJXLGHOLQHVIRUWKHFRUUHFWLRQRILQDFFXUDWHRUPLVOHDGLQJ GDWDWKURXJKLQIRUPDODQGIRUPDOKHDULQJV6WXGHQWVDOVRKDYH A student who falls below this minimum will be placed on WKHULJKWWR¿OHFRPSODLQWVZLWK7KH)DPLO\(GXFDWLRQDO5LJKWV academic probation. A student who is on academic probation will DQG3ULYDF\$FW2I¿FHFRQFHUQLQJDOOHJHGIDLOXUHVE\WKH FRQWLQXHRQSUREDWLRQZKHQDVHPHVWHUDYHUDJHLVRUJUHDWHU institution to comply with the Act. LIWKHFXPXODWLYHDYHUDJHLVEHORZWKDWUHFRPPHQGHGDERYH7KH $VWXGHQW¶VDFDGHPLFUHFRUGVDUHFRQVLGHUHGFRQ¿GHQWLDO LQGLYLGXDOLVHQFRXUDJHGWRXVHWKHDFDGHPLF³VHFRQGFKDQFH´ information. Without the student’s expressed written permission, RSWLRQWRLPSURYHWKHFXPXODWLYHDYHUDJH they are accessible only to College personnel who keep the UHFRUGVRUQHHGWRKDYHLQIRUPDWLRQWRKHOSWKHVWXGHQW $VWXGHQWRQSUREDWLRQZKRVHFXPXODWLYHDYHUDJHLVOHVVWKDQ WKDWUHFRPPHQGHGDERYHDQGZKRVHVHPHVWHUDYHUDJHLVOHVV "Directory Information" may be released to the public and is WKDQRUDQ\VWXGHQWZKRVHVHPHVWHUDYHUDJHLVEHORZ GLYLGHGLQWRWKHIROORZLQJFDWHJRULHV will no longer be considered in good academic standing and will be suspended for one semester. Any time after the semester Category I VXVSHQVLRQWKHLQGLYLGXDOPD\DSSO\IRUUHDGPLVVLRQRQ Name, address, telephone number, dates of academic probation. attendance, class roster, class schedule, e-mail address Any student who re-enrolls following a suspension and fails to PHHWWKHDERYHFULWHULDDIWHURQHRUPRUHDGGLWLRQDOVHPHVWHUV Category II will be suspended for one calendar year. 3UHYLRXVLQVWLWXWLRQ V DWWHQGHGPDMRUV DZDUGVKRQRUV LQFOXGHG'HDQ VOLVW Any student who re-enrolls after two suspensions and fails to GHJUHH V FRQIHUUHGDQGGDWHVVWDWXV IXOOSDUWWLPH PHHWWKHDERYHFULWHULDDIWHURQHRUPRUHVHPHVWHUVRIDGGLWLRQDO work will be dismissed from school. Category III 3DVWDQGSUHVHQWSDUWLFLSDWLRQLQRI¿FLDOO\ Athletic Eligibility UHFRJQL]HGVSRUWVDQGDFWLYLWLHVSK\VLFDO 7REHHOLJLEOHWRUHSUHVHQW'H¿DQFH&ROOHJHLQLQWHUFROOHJLDWH IDFWRUV KHLJKWZHLJKWRIDWKOHWHV GDWHDQG athletics competition, a student-athlete shall be enrolled in at least place of birth, and photograph 12 semester hours of course work, be in good academic standing and maintain satisfactory progress toward a baccalaureate degree. Students may request that all directory information, or certain For athletic eligibility purposes, good academic standing and categories, be withheld by notifying the Registration Center in VDWLVIDFWRU\SURJUHVVDUHGH¿QHGDVEHLQJHOLJLEOHWRHQUROODW ZULWLQJZLWKLQWKH¿UVWZHHNRIDWHUP6WXGHQWVVKRXOGFRQWDFW 'H¿DQFH&ROOHJHIRUDSDUWLFXODUWHUP the Registrar for additional information concerning the Family 5LJKWVDQG3ULYDF\$FW Academic Honors Dean’s List:$IWHUHYHU\IDOODQGVSULQJWHUPVWXGHQWVZKRKDYH Majors & Requirements 31 DFKLHYHGDJUDGHSRLQWDYHUDJHRIRUDERYHDUHKRQRUHGE\WKH Accounting (AC) publication of their names on the Dean’s List. To be eligible, a Associate Professors W. O’Toole and M. Gallagher student must be enrolled in 12 or more semester hours for which OHWWHUJUDGHVDUHJLYHQ*UDGHVHDUQHGLQGHYHORSPHQWDO $FFRXQWLQJLVWKHV\VWHPRIFRPSLOLQJDQGDQDO\]LQJ¿QDQFLDO courses cannot be used to determine eligibility for the Dean’s GDWDWRSURYLGHXVHIXOLQIRUPDWLRQWRPDQDJHUVRZQHUVDQG List. FUHGLWRUV7KHDFFRXQWLQJPDMRULVGHVLJQHGIRUVWXGHQWVSODQQLQJ DSURIHVVLRQDOFDUHHULQDFFRXQWLQJ7KHPDMRURIIHUVWZRWUDFNV Honors List:$IWHUHYHU\IDOODQGVSULQJWHUPVWXGHQWVZKR RIVWXG\2QHWUDFNSURYLGHVHGXFDWLRQDOUHTXLUHPHQWVIRUFHUWL- HQUROOHGLQVHPHVWHUKRXUVIRUZKLFKOHWWHUJUDGHVDUHJLYHQ ¿FDWLRQDVDPDQDJHPHQWDFFRXQWDQWRULQWHUQDODXGLWRU7KHDF- are honored by the publication of their names on the Honors List, FRXQWLQJPDMRUFRQVLVWVRIFUHGLWV7KHVHFRQGWUDFNLQFOXGHV LIWKH\KDYHDFKLHYHGDJUDGHSRLQWDYHUDJHRIRUKLJKHULQWKH additional semester hours in order to qualify the students to take semester coursework. WKH8QLIRUP&HUWL¿HG3XEOLF$FFRXQWLQJ([DPLQDWLRQLQ2KLR 7KHVHFUHGLWKRXUVLQFOXGHWKHKRXUVUHTXLUHGLQWKH¿UVWWUDFN Graduation Honors: Candidates for graduation, ZKRHQWHUHG SOXVDGGLWLRQDOFUHGLWKRXUVLQVXEMHFWDUHDVLQFOXGLQJOHDGHUVKLS 'H¿DQFH&ROOHJHGXULQJRUDIWHUWKHIDOOVHPHVWHU DQG technology, and communications. ZKRKDYHDFKLHYHGVSHFLDOGLVWLQFWLRQLQDFDGHPLFZRUNZLOO EHIRUPDOO\UHFRJQL]HGDWFRPPHQFHPHQWDQGZLOOKDYHWKH $FFRXQWLQJ0DMRUUHTXLUHPHQWVLQFOXGH following honors printed on their diplomas, as determined by $&)LQDQFLDO$FFRXQWLQJ VHYHQVHPHVWHUFXPXODWLYHJUDGHSRLQWDYHUDJHVLQFOXGLQJ $&0DQDJHULDO$FFRXQWLQJ transfer work: $&,QWHUPHGLDWH$FFRXQWLQJ, 6XPPD&XP/DXGH DQGDERYH $&,QWHUPHGLDWH$FFRXQWLQJ,, Magna Cum Laude - 3.7 to 3.89 AC 327 Federal Taxation (3) Cum Laude - 3.5 to 3.69 AC 330 Cost Management AC 370 Accounting Information Systems $& $XGLWLQJ Division Structure $& ,VVXHVLQ$FFRXQWLQJ 7KHDFDGHPLFRUJDQL]DWLRQRIWKH&ROOHJHFRQVLVWVRI¿YH %$4XDQWLWDWLYH%XVLQHVV$QDO\VLV GLYLVLRQV7KRVHGLYLVLRQVWKHLU&KDLUVDQGWKHGLVFLSOLQHVWKH\ %$%XVLQHVV6WDWLVWLFV include are: %$%XVLQHVV&RPPXQLFDWLRQ %$%XVLQHVV(WKLFV $UWVDQG+XPDQLWLHV'LYLVLRQ'U0LFKDHO6RSHU&KDLU %$%XVLQHVV/DZ &RXUVHVRIIHUHGLQ$UW $5 $UWVDQG+XPDQLWLHV $+ %$ %XVLQHVV3ROLF\ &RPPXQLFDWLRQ$UWV &$ (QJOLVK (1 *HQHUDO6WXGLHV *6 (&0LFURHFRQRPLFV +LVWRU\ +, 0XVLF 08 5HOLJLRQ 5/ DQG6SDQLVK 63 (&0DFURHFRQRPLFV ),%XVLQHVV)LQDQFH %HKDYLRUDODQG$SSOLHG6RFLDO6FLHQFH'LYLVLRQ3URI6WHYH 0*3ULQFLSOHVRI0DQDJHPHQW Sondergaard, Chair 0*+XPDQ5HVRXUFH0DQDJHPHQW &RXUVHVRIIHUHGLQ&ULPLQDO-XVWLFH &- 3ROLWLFDO6FLHQFH 36 0*0DQDJHPHQW,QIRUPDWLRQ6\VWHPV 3V\FKRORJ\ 3< 6RFLDO:RUN 6: DQG6RFLRORJ\ 62 0.3ULQFLSOHVRI0DUNHWLQJ ,76SUHDGVKHHWV %XVLQHVV'LYLVLRQ'U0LFKDHO*DOODJKHU&KDLU &RXUVHVRIIHUHGLQ$FFRXQWLQJ $& %XVLQHVV$GPLQLVWUDWLRQ KRXU&3$WUDFNPDMRULQFOXGHVWKH$FFRXQWLQJ0DMRUUH- %$ (FRQRPLFV (& )LQDQFH ), 0DQDJHPHQW 0* TXLUHPHQWVDERYHSOXV 0DUNHWLQJ 0. DQG,QIRUPDWLRQ7HFKQRORJ\ ,7 $&)HGHUDO7D[DWLRQ $&$GYDQFHG$FFRXQWLQJ (GXFDWLRQ'LYLVLRQ'U6X]DQQH0F)DUODQG&KDLU $& ,QWHUQVKLS&RRSHUDWLYH(GXFDWLRQ &RXUVHVRIIHUHGLQ$WKOHWLF7UDLQLQJ(GXFDWLRQ $7 (GXFDWLRQ $& ,VVXHVLQ$FFRXQWLQJ (' 6SRUW6FLHQFH3K\VLFDO(GXFDWLRQ 3( 6SRUW0DQDJHPHQW 0*6PDOO%XVLQHVV0DQDJHPHQW 60 DQG:HOOQHVV :( &$6PDOO*URXS&RPPXQLFDWLRQ &$2UJDQL]DWLRQDO&RPPXQLFDWLRQ 6FLHQFHDQG0DWKHPDWLFV'LYLVLRQ3URI'DYLG5HHG&KDLU BA 501 Organizational Management and Leadership &RXUVHVRIIHUHGLQ%LRORJ\ %, &KHPLVWU\ &+ 0DWKHPDWLFV %$(WKLFVIRU/HDGHUVKLS 0$ 1DWXUDO6FLHQFH 16 (QYLURQPHQWDO6FLHQFH3K\VLFV %$/HDGHUVKLSDQG2UJDQL]DWLRQDO%HKDYLRU 3+ DQG5HVWRUDWLRQ(FRORJ\ %$2UJDQL]DWLRQDO6\VWHPVDQG6WUDWHJ\'HYHORSPHQW 3OXVHOHFWLYHVWRWRWDOKRXUV. Majors & Requirements 32 Art (AR) Athletic Training Education (AT) Professor S. Smith, Asst. Professor D. Fiely Assistant Professor K. Tong and C. Studrawa, Program Director 7KHRIIHULQJVLQDUWVWULYHWRFXOWLYDWHDQXQGHUVWDQGLQJRIWKH¿QH 7KH$WKOHWLF7UDLQLQJ(GXFDWLRQ3URJUDP $7(3 LVDXQLTXHSUR- DUWVDVDQLPSRUWDQWIDFWRULQDOLEHUDOHGXFDWLRQDQGWRSURYLGH JUDPWKDWFRPELQHVLQWHQVLYHFRXUVHZRUNZLWKKDQGVRQFOLQLFDO experience in the theory, practice and history of the arts which experience to prepare a student for a career in athletic training. will prepare the student for teaching or further professional study. The program is based upon the educational competencies estab- $UWPDMRUVPXVWSDUWLFLSDWHLQDVHQLRUH[KLELWLRQDVDFDSVWRQH OLVKHGE\WKH1DWLRQDO$WKOHWLF7UDLQHUV¶$VVRFLDWLRQ 1$7$ DQG experience. the standards and guidelines established by the Commission on $FFUHGLWDWLRQRI$OOLHG+HDOWK(GXFDWLRQ3URJUDPV &$$+(3 7KHDUWPDMRUUHTXLUHVVHPHVWHUKRXUVLQFOXGLQJ $5&RORUDQG'HVLJQ, 6WXGHQWVHQWHU'H¿DQFH&ROOHJHDVSUHDWKOHWLFWUDLQLQJPDMRUV $5&RORUDQG'HVLJQ,, DQGPXVWFRPSOHWHWKH¿UVW\HDUFRQVLVWLQJRIJHQHUDOHGXFDWLRQ $5'UDZLQJ degree requirements and athletic training prerequisite courses. $5,QWURGXFWLRQWR3DLQWLQJ The ATEP is a limited enrollment program and accepts a maxi- $5&HUDPLFV mum of 10 students per year. Students are admitted at the end of $5$UW+LVWRU\, their freshman year before beginning the program in their sopho- $5$UW+LVWRU\,, more year. All students entering the ATEP must make a formal $5/LIH'UDZLQJ application, be admitted to the program, and follow a prescribed, $56FXOSWXUH sequenced course of study. The requirements for admission into $5+LVWRU\RI$PHULFDQ$UW the ATEP are as follows: SOXVKRXUVRI$UWHOHFWLYHV 1. Completion of all programs application forms 2. Completion of AT 100, AT 200 and PE 121 with a The Art Minor requires 18 hours and may be arranged in minimum grade of a B- in each course. consultation with the art faculty and the Registrar. 'RFXPHQWDWLRQRIDPLQLPXPRIFOLQLFDOREVHUYDWLRQ KRXUVXQGHUWKHVXSHUYLVLRQRID&HUWL¿HG$WKOHWLF $Q$VVRFLDWHRI$UWGHJUHHLVDYDLODEOHDQGUHTXLUHPHQWVLQFOXGH Trainer. $5&RORUDQG'HVLJQ, 4. Successful completion of Athletic Training Modules $5&RORUDQG'HVLJQ,, /HYHOGXULQJDFDGHPLFFOLQLFDOKRXUV $5'UDZLQJ 0LQLPXPFXPXODWLYH'&*3$RIRQDVFDOH $5,QWURGXFWLRQWR3DLQWLQJ 2EMHFWLYH(YDOXDWLRQVIURPFHUWL¿HGVWDIILQFOXGLQJ $5&HUDPLFV (YDOXDWLRQEDVHGRQSURIHVVLRQDOLVPZRUNHWKLF $5/LIH'UDZLQJ dependability, taping skills and techniques, record $56FXOSWXUH keeping. DQ\$UW+LVWRU\FRXUVH 7. Two letters of recommendation SOXVKRXUVRI$UWHOHFWLYHV 3HUVRQDOLQWHUYLHZZLWKSURJUDPVHOHFWLRQFRPPLWWHH 9HUL¿FDWLRQRISK\VLFDOH[DPLQDWLRQDQGDELOLW\WRPHHW Technical Standards of the ATEP. Arts and Humanities (AH) 10. Proof of immunizations including measles, mumps, 7KHPDMRUUHTXLUHVVHPHVWHUKRXUVLQFOXGLQJ rubella, tetanus, diphtheria and hepatitis B. The student PD\VLJQDQDVVXPSWLRQRIULVNZDLYHULQOLHXRI Arts and Humanities general education requirements, UHFHLYLQJWKH+HSDWLWLV%YDFFLQH7KH$7(3VWURQJO\ SOXVDGGLWLRQDORUOHYHO$UWVRU+XPDQLWLHVFRXUVHV UHFRPPHQGVWKHVWXGHQWUHFHLYLQJWKH+HSDWLWLV% DQG$+ /LEHUDO$UWV,QWHUGLVFLSOLQDU\6HPLQDU YDFFLQH The Arts and Humanities minor requires the Arts & Humanities 7HFKQLFDO6WDQGDUGVIRU$GPLVVLRQ: JHQHUDOHGXFDWLRQUHTXLUHPHQWVSOXVRWKHURUOHYHO Technical standards establish essential qualities considered Arts or Humanities courses. QHFHVVDU\IRUVWXGHQWVWRDFKLHYHWKHNQRZOHGJHVNLOOVDQG FRPSHWHQFLHVRIDQHQWU\OHYHODWKOHWLFWUDLQHUDVZHOODVPHHWWKH expectations of athletic training education accrediting agency- CAAHEP. Candidates for selection must demonstrate: Mental capacity to formulate assessment and WKHUDSHXWLFMXGJPHQWV Postural neuromuscular control to perform tasks and safely use equipment Majors & Requirements 33 6WURQJZULWWHQDQGYHUEDOFRPPXQLFDWLRQVNLOOV Biology (BI) $ELOLW\WRIXQFWLRQLQDVWUHVVIXOHQYLURQPHQW Professor Emeritus B. Mikula, Associate Prof. D. Reed and E. )OH[LELOLW\DQGSHUVHYHUDQFHWRDGMXVWWRFKDQJLQJ 6FKXUWHU$VVLVWDQW3URIHVVRUV1*ULJJVDQG60DYURLGLV situations $IIHFWLYHVNLOOVUHODWHGWRSURIHVVLRQDOEHKDYLRUVLQWKH 7KH%LRORJ\PDMRUUHTXLUHVVHPHVWHUKRXUVDQGLQFOXGHV KHDOWKFDUH¿HOG %,%RWDQ\ %, =RRORJ\ 7KHPHHWLQJRIDGPLVVLRQUHTXLUHPHQWVGRHVQRWKRZHYHU %,&RPSDUDWLYH9HUWHEUDWH$QDWRP\ guarantee admission to the ATEP. The Selection Committee %,*HQHWLFV is composed of the faculty and staff of the ATEP. Criteria for &+*HQHUDO&KHPLVWU\, selection include the strength of their academic record with &+*HQHUDO&KHPLVWU\,, SDUWLFXODUHPSKDVLVLQ$7DQG$7REVHUYDWLRQKRXUV 16 6HPLQDU WRWDORIKRXUV at the clinical sites and personal characteristics of the student 16 6HQLRU&DSVWRQH3URMHFW WKDWDUHLPSRUWDQWLQZRUNLQJLQWKHKHDOWKFDUH¿HOG$OO DQGHOHFWLYHVLQ%LRORJ\&KHPLVWU\DQG1DWXUDO6FLHQFHWRWRWDO DWKOHWLFWUDLQLQJVWXGHQWV $76 ZKRDUHIRUPDOO\DGPLWWHGPXVW KRXUVLQVFLHQFH SOXV complete the academic core of athletic training courses and 0$3UH&DOFXOXV0DWKHPDWLFV complete all modules. These modules will take a minimum 3<%HKDYLRUDO6WDWLVWLFV RU%$4XDQWLWDWLYH%XVLQHVV of 6 semesters to complete. Liability insurance is required of $QDO\VLV,, all students that enter the professional phase of the ATEP. The and three hours in Information Technology insurance is a requirement for AT 290, 390 and 490. Additional program requirements will be detailed in the ATEP Policies DQG3URFHGXUHV0DQXDOWKDWWKHVWXGHQWVUHFHLYHLQ$7 Business Additional questions and concerns should be directed to the %XVLQHVVLVDSURIHVVLRQDOVWXG\UHTXLULQJFRPSUHKHQVLYH Program Director of the ATEP. FRYHUDJHRIDOOIXQFWLRQDODUHDVRIWKHEXVLQHVVHQYLURQPHQW ZLWKRXWVDFUL¿FLQJDQDZDUHQHVVRIWKHDUWVVFLHQFHVDQG 7KHPDMRUUHTXLUHVVHPHVWHUKRXUVLQFOXGLQJ KXPDQLWLHV7KHIDFXOW\¶VREMHFWLYHVJREH\RQGWKHWUDLQLQJ $7 ,QWURGXFWLRQWR$WKOHWLF7UDLQLQJ RIWHFKQLFLDQVWRHQFRXUDJLQJWKRVHDELOLWLHVLQLWLDWLYHVDQG $7 2UWKRSHGLF,QMXU\3DWKRORJ\ analytical skills which characterize the well-educated citizen. $7 *HQHUDO0HGLFDO&RQGLWLRQV $7 3UDFWLFXP, 7KH%XVLQHVVDUHDRIIHUVPDMRUVLQ%XVLQHVV$GPLQLVWUDWLRQ $7 3UDFWLFXP,, Management, Human Resource Management, Marketing, $7 7KHUDSHXWLF0RGDOLWLHV Accounting, and Finance. Refer to the appropriate section for $7 3KDUPDFRORJ\ course requirements. $7 1XWULWLRQ 7KHIDFXOW\LQEXVLQHVVVWULYHWRSUHSDUHWKHLUJUDGXDWHVWRZRUN $7 3UDFWLFXP,,, VXFFHVVIXOO\LQWKHEXVLQHVVZRUOGWRWKLQNFUHDWLYHO\DERXW $7 3UDFWLFXP,9 EXVLQHVVSUREOHPVDQGWRPDNHEXVLQHVVGHFLVLRQV7RDFKLHYH $7 (YDOXDWLRQRI$WKOHWLF,QMXULHV, WKLVWKH\VHHNWRHGXFDWHWKHLUPDMRUVLQIRXUGLIIHUHQWW\SHVRI $7 (YDOXDWLRQRI$WKOHWLF,QMXULHV,, VNLOOV FRPPXQLFDWLYH TXDQWLWDWLYH LQWHJUDWLYHDQG $7 7KHUDSHXWLF([HUFLVH VSHFLDOL]HG FRPPXQLFDWLYHVNLOOVFRQFHUQVSHDNLQJZULWLQJ AT 481 Organization and Administration of Health, Physical and otherwise communicating ideas to assert leadership and reach (GXFDWLRQDQG6SRUW GHFLVLRQV4XDQWLWDWLYHVNLOOVLQYROYHEHLQJDEOHWRFDOFXODWH $7 3UDFWLFXP9 DQDO\]HDQGXQGHUVWDQGQXPHULFDOGDWD,QWHJUDWLYHVNLOOVDOORZ $7 3UDFWLFXP9, a person to understand how parts relate to the whole, how the %, $QDWRP\DQG3K\VLRORJ\, YDULRXVIXQFWLRQVRIDEXVLQHVVHQWHUSULVHUHODWHWRHDFKRWKHUDQG %, $QDWRP\DQG3K\VLRORJ\,, how business in general relates to political, social, and cultural PE 121 Foundations of Health, Physical Education, and Sport forces of the wider world. Specialized skills are those needed to REWDLQWKDW¿UVWMREDIWHUJUDGXDWLRQ 3( (YDOXDWLRQDQG0HDVXUHPHQWLQ+HDOWKDQG3K\VLFDO (GXFDWLRQ 3( ([HUFLVH3K\VLRORJ\ 3( .LQHVLRORJ\DQG%LRPHFKDQLFV 3< ,QWURGXFWLRQWR3V\FKRORJ\ 3< 5HVHDUFK0HWKRGV Majors & Requirements 34 Business Administration (BA) Chemistry (CH) 3URIHVVRU5.RKO $VVRFLDWH3URIHVVRUV:2 7RROH6:DMHUW Assistant Professors M. Bourque, E. Schurter and W. Buchanan $&KHPLVWU\HPSKDVLVLVDYDLODEOHDVD1DWXUDO6FLHQFHPDMRU 7KH%XVLQHVVDUHDRIIHUVPDMRUVLQ%XVLQHVV$GPLQLVWUDWLRQ Requirements include: Human Resource Management, Management, Marketing, Ac- %,%RWDQ\ RU%, =RRORJ\ counting and Finance. Refer to the appropriate section for course &+*HQHUDO&KHPLVWU\,,, UHTXLUHPHQWV7KHIDFXOW\LQEXVLQHVVVWULYHVWRSUHSDUHWKHLU &+2UJDQLF&KHPLVWU\,,, graduates to work successfully in the business world, to think &+%LRFKHPLVWU\, FUHDWLYHO\DERXWEXVLQHVVSUREOHPVDQGWRPDNHEXVLQHVVGHFL- &+4XDQWLWDWLYH$QDO\VLV VLRQV7RDFKLHYHWKLVWKH\VHHNWRHGXFDWHWKHLUPDMRUVLQIRXU 16 6HPLQDU WRWDORIFUHGLWV GLIIHUHQWW\SHVRIVNLOOV FRPPXQLFDWLYH TXDQWLWDWLYH 16 6HQLRU&DSVWRQH LQWHJUDWLYHDQG VSHFLDOL]HG&RPPXQLFDWLYHVNLOOVFRQFHUQ 3+*HQHUDO3K\VLFV, speaking, writing, and otherwise communicating ideas to assert 3+*HQHUDO3K\VLFV,, OHDGHUVKLSDQGUHDFKGHFLVLRQV4XDQWLWDWLYHVNLOOVLQYROYHEHLQJ DQGDSSURYHGHOHFWLYHVLQVFLHQFHWRWRWDOKRXUVSOXV able to calculate, analyze and understand numerical data. Inte- FUHGLWVLQPDWKHPDWLFVDWWKHOHYHORUDERYHDQGFUHGLWVLQ JUDWLYHVNLOOVDOORZDSHUVRQWRXQGHUVWDQGKRZSDUWVUHODWHWRWKH Information Technology ZKROHKRZWKHYDULRXVIXQFWLRQVRIDEXVLQHVVHQWHUSULVHUHODWH to each other, and how business in general relates to political, social and cultural forces of the wider world. Specialized skills Christian Education See Religious Studies DUHWKRVHQHHGHGWRREWDLQWKDW¿UVWMREDIWHUJUDGXDWLRQ 7KHPDMRUUHTXLUHVVHPHVWHUKRXUVLQWKHEXVLQHVVFRUHLQFOXG- Communication Arts (CA) ing: Associate Professor N. Schaefer-Faix, Assistant Professors A. $&)LQDQFLDO$FFRXQWLQJ Drees, J. Williams $&0DQDJHULDO$FFRXQWLQJ %$4XDQWLWDWLYH%XVLQHVV$QDO\VLV 6WXG\LQJFRPPXQLFDWLRQGHYHORSVDQGHQKDQFHVDQLQGLYLGXDO¶V %$%XVLQHVV6WDWLVWLFV ability to function in society. Communication skills not only %$%XVLQHVV&RPPXQLFDWLRQ enrich relationships, but they are also requirements in a rapidly %$%XVLQHVV(WKLFV changing world. %$%XVLQHVV/DZ %$ %XVLQHVV3ROLF\ Communication arts can prepare students for careers in such (&0LFURHFRQRPLFV ¿HOGVDVHGXFDWLRQMRXUQDOLVPSXEOLFUHODWLRQVDQGVSHHFK (&0DFURHFRQRPLFV FRPPXQLFDWLRQ,WFDQSURYLGHWKHEDVLVIRUIXWXUHJUDGXDWH ),%XVLQHVV)LQDQFH VWXG\LQWKHVH¿HOGVDQGRWKHUV²VXFKDVDGYHUWLVLQJRUODZ ,76SUHDGVKHHWV ,WFDQSURYLGHWKHVWXGHQWLQWHUHVWHGLQDWHDFKLQJFDUHHUZLWK 0*3ULQFLSOHVRI0DQDJHPHQW competence in a number of areas. 0*+XPDQ5HVRXUFH0DQDJHPHQW 0.3ULQFLSOHVRI0DUNHWLQJ 7KHPDMRUUHTXLUHVKRXUVRIFRUH&RPPXQLFDWLRQ$UWVFRXUVHV 0*0DQDJHPHQW,QIRUPDWLRQ6\VWHPV including: &$0HGLD&RPPXQLFDWLRQ $Q$VVRFLDWHRI$UWVGHJUHHLVDYDLODEOHLQ%XVLQHVV$GPLQLVWUD- &$,QWURGXFWLRQWR0HGLD tion. Business requirements total 36 semester hours and include: &$&RPPXQLFDWLRQ7KHRU\DQG+LVWRU\ $&)LQDQFLDO$FFRXQWLQJ &$6RSKRPRUH3RUWIROLR'HYHORSPHQW $&0DQDJHULDO$FFRXQWLQJ &$6PDOO*URXS&RPPXQLFDWLRQ %$4XDQWLWDWLYH%XVLQHVV$QDO\VLV &$3XEOLF2SLQLRQDQG3URSDJDQGD %$%XVLQHVV6WDWLVWLFV &$,QWHUSHUVRQDO&RPPXQLFDWLRQ %$%XVLQHVV&RPPXQLFDWLRQ &$0DVV&RPPXQLFDWLRQ %$%XVLQHVV(WKLFV &$&ULWLFDO3XEOLF$GGUHVV (&0LFURHFRQRPLFV &$3HUVXDVLRQ (&0DFURHFRQRPLFV &$&RPPXQLFDWLRQDQG3HUIRUPDQFH ),%XVLQHVV)LQDQFH &$3XEOLF$GYRFDF\ 0*3ULQFLSOHVRI0DQDJHPHQW &$2UJDQL]DWLRQDO&RPPXQLFDWLRQ 0.3ULQFLSOHVRI0DUNHWLQJ &$ ,QWHUQVKLS 3OXVVHPHVWHUKRXUVRIEXVLQHVVHOHFWLYHV RU&$ &RRSHUDWLYH(GXFDWLRQ Majors & Requirements 35 &$ 6HPLQDU&DSVWRQH &-&ULPLQDO(YLGHQFHDQG3URFHGXUH (1$GYDQFHG&RPSRVLWLRQ &-,QWURGXFWLRQWR&RUUHFWLRQV &-&ULPLQDO-XVWLFH2UJDQL]DWLRQDQG$GPLQLVWUDWLRQ In addition, one of the following three tracks must be completed: &-&ULPLQDO-XVWLFH6HPLQDU General Track &- )LHOG([SHULHQFH &$3XEOLF5HODWLRQV 3<%HKDYLRUDO6WDWLVWLFV &$0HGLDWLRQ 3<625HVHDUFK0HWKRGV $QGDQ\WKUHH FRXUVHVFKRVHQIURP plus 12 hours selected from the remaining CJ courses &$:HE'HVLJQ concentrating either in law enforcement or corrections &$ 6SHFLDO7RSLFV &$ ,QGHSHQGHQW6WXG\ The Criminal Justice minor consists of 18 credits, including: 0.3ULQFLSOHVRI0DUNHWLQJ &-,QWURGXFWLRQWR&ULPLQDO-XVWLFH 0.$GYHUWLVLQJ &-&ULPLQDO/DZ %$%XVLQHVV&RPPXQLFDWLRQ &-&ULPLQDO,QYHVWLJDWLRQ SOXV FUHGLWVRI&-FRXUVHVQXPEHUHGDQGDERYH Performing Arts Track concentrating in law enforcement or corrections &$,QWURGXFWLRQWR$FWLQJ &$$GYDQFHG$FWLQJ ±WKLVFRXUVHVKRXOGEHWDNHQWZLFH The Associate of Arts Degree in Criminal Justice is also &$7KHDWUH'LUHFWLQJDQG'HVLJQ ±WKLVFRXUVHVKRXOGEH DYDLODEOH taken twice Required courses include the general education requirements for the associate of arts degree and the following: Media Studies Track &-,QWURGXFWLRQWR&ULPLQDO-XVWLFH &$,QWURGXFWLRQWR)LOP &-,QWURGXFWLRQWR-XYHQLOH'HOLQTXHQF\ &$0HGLD5DFHDQG*HQGHU &-&ULPLQDO/DZ &$+LVWRU\DQG3URJUDPPLQJRI(OHFWURQLF0HGLD &-&ULPLQDO,QYHVWLJDWLRQ &$0DVV0HGLDDQG6RFLHW\ &-&ULPLQDO(YLGHQFHDQG3URFHGXUH &$0HGLDDQG&XOWXUDO&ULWLFLVP &-,QWURGXFWLRQWR&RUUHFWLRQV 3<,QWURGXFWLRQWR3V\FKRORJ\ $&RPPXQLFDWLRQ$UWVPLQRULVDYDLODEOHDQGUHTXLUHVKRXUV 62/LIHLQ6RFLHW\ including: And nine credits from the following list: &$6PDOO*URXS&RPPXQLFDWLRQ 626RFLDO3UREOHPV &$&RPPXQLFDWLRQ7KHRU\ 62&XOWXUDO'LYHUVLW\ &$6RSKRPRUH3RUWIROLR'HYHORSPHQW 3< $EQRUPDO3V\FKRORJ\ &$,QWHUSHUVRQDO&RPPXQLFDWLRQ 3<,QIDQF\DQG&KLOGKRRG &$0DVV&RPPXQLFDWLRQ 3<$GROHVFHQFHDQG$GXOWKRRG &$3HUVXDVLRQ 36$PHULFDQ1DWLRQDO*RYHUQPHQW &$0HGLDWLRQ 36$PHULFDQ6WDWHDQG/RFDO*RYHUQPHQW 3OXVKRXUVRI&$FRXUVHVDWWKHOHYHORUDERYH +,+LVWRU\RIWKH&RQVWLWXWLRQ 36&RQVWLWXWLRQDO/DZ Criminal Justice (CJ) Design for Leadership 3URIHVVRU'.QXHYH$VVRFLDWH3URIHVVRU66RQGHUJDDUG See Religious Studies 7KHEDFFDODXUHDWHGHJUHHSURJUDPLQFULPLQDOMXVWLFHVWULYHV WRSURYLGHDJRRGEDFNJURXQGLQDOODUHDVRIFULPLQDOMXVWLFH Economics (EC) Professor R. Kohl WRDOORZFRQFHQWUDWLRQLQRQHRIVHYHUDODUHDVDQGWRSUHSDUH VWXGHQWVIRUHQWU\OHYHOSRVLWLRQVLQDYDULHW\RIFULPLQDOMXVWLFH agencies, as well as prepare students for graduate school. 2SHQWRDOOPDMRUVRIWKHFROOHJHWKHPLQRULQ(FRQRPLFV LVGHVLJQHGWRSURYLGHVWXGHQWVZLWKDQDSSUHFLDWLRQIRUWKH principles of constrained choice. Recognized as the most highly 7KH&ULPLQDO-XVWLFHPDMRUFRQVLVWVRIFUHGLWVDQGLQFOXGHV systematized of the social sciences, Economics as a discipline &-,QWURGXFWLRQWR&ULPLQDO-XVWLFH employs a wide range of critical thinking skills in a way that &-,QWURGXFWLRQWR-XYHQLOH'HOLQTXHQF\ OHQGVRUGHUWRHYHQWVWDNLQJSODFHDWORFDOQDWLRQDODQGJOREDO &-&ULPLQDO/DZ OHYHOV$FRPPDQGRILWVSULQFLSOHVWKXVSURYLGHVWKRVHSXUVXLQJ &-&ULPLQDO,QYHVWLJDWLRQ Majors & Requirements 36 DZLGHUDQJHRIGLYHUVHFDUHHUVZLWKDQDELOLW\WRGHVFULEHDQG Report on the Quality of Teacher Education predict changes and trends in the pattern of public affairs. As part of the Title II Higher Education Act, all colleges and XQLYHUVLWLHVZLWKWHDFKHUSUHSDUDWLRQSURJUDPVZKHUHVWXGHQWV Economics Minor Requirements include: UHFHLYHIHGHUDODVVLVWDQFHXQGHU7LWOH,9RIWKDWDFWPXVWUHSRUW (&0LFURHFRQRPLFV assessment data on their teacher education “program completers.” (&0DFURHFRQRPLFV Program Completer refers to anyone who completes all (&0RQH\DQG%DQNLQJ UHTXLUHPHQWVIRUDQ\RIWKHDSSURYHGWHDFKHUHGXFDWLRQ (&3XEOLF)LQDQFH programs. This year’s data is based on a group of 53 students (&,QWHUQDWLRQDO7UDGH who completed programs during the 2002-2003 school year. The %$%XVLQHVV6WDWLVWLFV RYHUDOOSDVVUDWHIRUWKHVHVWXGHQWVRQVWDWHUHTXLUHGWHVWVZDV +RZHYHURIWKHVWXGHQWVLQWKLVJURXSZKRFRPSOHWHGWKH new programs in Early Childhood Licensure, Middle Childhood Education (ED) Licensure, Adolescent and Young Adult Licensure and Pre-K 3URIHVVRU60F)DUODQG $VVRFLDWH3URIHVVRU75LFNDEDXJK ±0XOWL$JH/LFHQVXUH3URJUDPVWKHRYHUDOOSDVVUDWHRQVWDWH $VVLVWDQW3URIHVVRUV-%XUNKDUGW7&DVH)&RXOWHU00DWKHU required tests was 100%. Those students were required to pass Instructors D. Kaiser, R. Kratzer, R. Lydum the state required content test prior to their student teaching/ internship and the state required test on teaching principles before 7KH(GXFDWLRQIDFXOW\ VREMHFWLYHLVWRSUHSDUHVWXGHQWVWR applying for licensure. EHFRPHHIIHFWLYHIDFLOLWDWRUVRIOHDUQLQJ7KHFXUULFXOXPSURYLGHV the student with opportunities to learn both the theoretical and 7KH&ROOHJHRIIHUVWKHIROORZLQJPDMRUVOHDGLQJWRWHDFKHU practical aspects of teaching. Since the State Department of OLFHQVXUH (DUO\&KLOGKRRG DJHWKURXJKJUDGH 0LGGOH Education periodically changes teacher licensure requirements, &KLOGKRRG JUDGHVWKURXJK IRUWZR¿HOGVVHOHFWHGIURP WKH&ROOHJHUHVHUYHVWKHULJKWWRPRGLI\LWVSURJUDPVDQG Reading/Language Arts, Mathematics, Science, and Social requirements to meet changing state standards. The professional 6WXGLHV ,QWHJUDWHG/DQJXDJH$UWV YDOLGIRUWHDFKLQJUHDGLQJ FRXUVHVDQGWKHWHDFKLQJ¿HOGVRXWOLQHGLQWKLVSXEOLFDWLRQPHHW (QJOLVKVSHHFKDQGMRXUQDOLVPLQJUDGHVWKURXJK the current state standards for teacher licensure in Ohio. Students ,QWHJUDWHG0DWKHPDWLFV JUDGHVWKURXJK ,QWHJUDWHG6RFLDO LQWHUHVWHGLQWHDFKLQJLQDQRWKHUVWDWHDUHDGYLVHGWRFRQWDFWWKDW 6WXGLHV YDOLGIRUWHDFKLQJKLVWRU\SROLWLFDOVFLHQFHJHRJUDSK\ VWDWH VGHSDUWPHQWRIHGXFDWLRQWRGHWHUPLQHLIWKH2KLRWHDFKLQJ SV\FKRORJ\VRFLRORJ\DQGHFRQRPLFVLQJUDGHVWKURXJK license will transfer to a comparable license in that state. All /LIH6FLHQFH YDOLGIRUWHDFKLQJELRORJ\DQGWKHOLIHVFLHQFHV education students should be aware that the requirements for LQJUDGHVWKURXJK /LIH6FLHQFHDQG&KHPLVWU\ YDOLGIRU JUDGXDWLRQDUHH[WHQVLYHDQGWKDWFDUHIXOSODQQLQJLVQHFHVVDU\ WHDFKLQJWKHOLIHVFLHQFHVDQGFKHPLVWU\LQJUDGHVWKURXJK and Multi-Age in Health Education, Physical Education, and Students admitted to the College who wish to be licensed as 9LVXDO$UWV YDOLGIRUWHDFKLQJWKHVXEMHFWIURPDJHWKURXJK teachers must be admitted to the teacher education program JUDGH +ROGHUVRIDQ(DUO\&KLOGKRRG/LFHQVHRU$GROHVFHQW and should indicate their desire to become a licensed teacher and Young Adult License can add a Middle Childhood License upon entering the College. Early and continuous monitoring in one content area with the appropriate content and education of students helps assure success in completing the program course work. See the Head of Teacher education for details. LQDPRUHWLPHO\PDQQHU6WXGHQWVPD\QRWWDNHXSSHUOHYHO HGXFDWLRQFRXUVHVXQWLODUHYLHZRIORZHUOHYHO¿HOGH[SHULHQFHV NOTE: At the time of printing, changes in Early Childhood and and coursework has been successfully completed and the student Middle Childhood requirements were being prepared to comply has obtained minimum scores of 176 in reading, 174 in writing, with Ohio Standards. These will affect students enrolling in the and 175 in math on the Praxis I. Each applicant seeking teacher 2004-2005 academic year. licensure is considered on the basis of criteria formulated by the Teacher Education Council and continuance in the program is Early Childhood Education GHSHQGHQWXSRQDSSURYDOE\WKDWJURXS7KHVHQLRUFDSVWRQH ('3KRQLFV H[SHULHQFHIRUDOOHGXFDWLRQPDMRUVLVDVHPHVWHUORQJLQWHUQVKLS (',QVWUXFWLRQDO7HFKQRORJ\ (')RXQGDWLRQVRI$PHULFDQ3XEOLF(GXFDWLRQ 7KHUHTXLUHPHQWVIRUDGPLVVLRQWRWHDFKHUHGXFDWLRQDUHDYDLODEOH ('(GXFDWLRQRI([FHSWLRQDO&KLOGUHQ from the Head of Teacher Education and will be distributed to (' (GXFDWLRQDO3V\FKRORJ\ each student during the ED 221 course. In the case of transfer ('3ULQFLSOHVRI(DUO\&KLOGKRRG(GXFDWLRQ students, the student should go to the Head of Teacher Education ('&XUULFXOXPDQG3UDFWLFHVRI(DUO\&KLOGKRRG and obtain a copy of the Teacher Education Handbook. This ('(DUO\&KLOGKRRG3UDFWLFXP, handbook is considered to be a part of this catalog. These ('3KRQLFVDQG(PHUJHQW/LWHUDF\ GRFXPHQWVFDQDOVREHIRXQGRQWKH'H¿DQFH&ROOHJHZHEVLWH ('(DUO\&KLOGKRRG3UDFWLFXP,, ZZZGH¿DQFHHGX ('([SUHVVLYH$UWV Majors & Requirements 37 ('2UJDQL]DWLRQRI3URJUDPVIRU (' $GYDQFHG)LHOG([SHULHQFH &+2UJDQLF&KHPLVWU\, (',QWHUQVKLSLQ$GROHVFHQW EC 375 International Trade (3) $5$GYDQFHG*UDSKLF'HVLJQ $5 ,QWHUQVKLS 0.$GYHUWLVLQJ Forensic Science &$0HGLD:ULWLQJ 6WXGHQWVLQWHUHVWHGLQWKH)RUHQVLF6FLHQFH0DMRUVKRXOGGLVFXVV DQGKRXUVRIHOHFWLYHVLQ$UW the demanding nature of the program and the desirability of continuing on to graduate school with a member of the Criminal Associate of Arts Degree in Graphic Design requirements: Justice or Natural Science faculty. AR111 Color and Design I AR112 Color and Design II The program requires 85 credit hours including: AR115 Graphic Design Principles %,+XPDQ$QDWRP\DQG3K\VLRORJ\,,, AR214 Basic Computer Design %,+LVWRORJ\ AR215 Intermediate Graphic Design %,*HQHWLFV AR221 Drawing &+*HQHUDO&KHPLVWU\,,, AR236 Photography &+2UJDQLF&KHPLVWU\,,, AR237 Art History I &+ %LR&KHPLVWU\,,, AR238 Art History II &+4XDQWLWDWLYH$QDO\VLV $5$GYDQFHG*UDSKLF'HVLJQ &-,QWURGXFWLRQWR&ULPLQDO-XVWLFH 7ZRFRXUVHVRI$UW(OHFWLYHV &-&ULPLQDO/DZ &-&ULPLQDO,QYHVWLJDWLRQ &-&ULPLQDO(YLGHQFHDQG3URFHGXUH Health Education (HE) &-,QWURGXFWLRQWR&ULPLQDOLVWLFV 7KLVPDMRUOHDGVWRDPXOWLDJHOLFHQVXUHWRWHDFK+HDOWKDJH ,7&RPSXWHU/LWHUDF\ through grade 12. Admission to the Teacher Education Program 0$3UHFDOFXOXV0DWK and other requirements are discussed in the Education section of 16 &RRSHUDWLYH(GXFDWLRQ RU WKHFDWDORJ7KHPDMRUUHTXLUHV 16 ,QWHUQVKLS 16 6HQLRU5HVHDUFK3URMHFW $73KDUPDFRORJ\ 3+3K\VLFV,,, $71XWULWLRQ 3<%HKDYLRUDO6WDWLVWLFV %,$QDWRP\ 3K\VLRORJ\, %,$QDWRP\ 3K\VLRORJ\,, General Studies (GS) +()RXQGDWLRQVRI+HDOWKDQG3K\VLFDO(GXFDWLRQ General Studies courses are designed to ensure better +(3HUVRQDO &RPPXQLW\+HDOWK +(6FKRRO+HDOWK6DIHW\DQG6HUYLFHV SHUIRUPDQFHLQDVWXGHQW¶VFROOHJHZRUNWKURXJKLPSURYHPHQWRI essental intellectual and academic skills. These courses may not +(3UH.*UDGH)LHOG3ODFHPHQW be counted as part of the 120 credits required for graduation but +(+HDOWK 3K\VLFDO$FWLYLW\IRU3UH. they are computed in the GPA. +((YDOXDWLRQLQ+HDOWK3K\VLFDO(GXFDWLRQDQG6SRUW +(([HUFLVH3K\VLRORJ\ +(6HFRQGDU\+HDOWK)LHOG3ODFHPHQW Geography (GE) +(6FKRRO+HDOWK,QVWUXFWLRQIRU0LGGOH6FKRRO *HRJUDSK\LVDVHUYLFHDUHD1RPDMRUVRUPLQRUVDUHRIIHUHG HE 481 Organization and Administration of Health, Physical (GXFDWLRQDQG6SRUW :( ,QWURGXFWLRQWR:HOOQHVV3URJUDPPLQJ Graphic Design Plus Assistant Professor A. Drees (',QVWUXFWLRQDO7HFKQRORJ\ (')RXQGDWLRQVRI$PHULFDQ3XEOLF(GXFDWLRQ $PDMRULQ*UDSKLF'HVLJQUHTXLUHVVHPHVWHUKRXUVLQFOXGLQJ ('(GXFDWLRQRI([FHSWLRQDO&KLOGUHQ $5&RORUDQG'HVLJQ, (' (GXFDWLRQDO3V\FKRORJ\ $5&RORUDQG'HVLJQ,, ('5HDGLQJLQWKH&RQWHQW)LHOG $5*UDSKLF'HVLJQ3ULQFLSOHV ('7HDFKLQJ6HFRQGDU\6WXGHQWV $5%DVLF&RPSXWHU'HVLJQ (',QWHUQVKLSLQ3UH.WR*UDGH $5,QWHUPHGLDWH*UDSKLF'HVLJQ (' ,QWHUQVKLS6HPLQDU $5'UDZLQJ 3(&RPPXQLW\)LUVW$LGDQG&35 $53KRWRJUDSK\ 3<,QIDQF\DQG&KLOGKRRG $5$UW+LVWRU\, 3<$GROHVFHQWDQG$GXOWKRRG $5$UW+LVWRU\,, History (HI) Professor M. Soper, Assistant. Professor D. Buerk Majors & Requirements 40 0.3ULQFLSOHVRI0DUNHWLQJ 7KH+LVWRU\PDMRUUHTXLUHGFUHGLWKRXUV 0*0DQDJHPHQW,QIRUPDWLRQ6\VWHPV +,86+LVWRU\WR +,(XURSHDQ+LVWRU\IURPWKH5HQDLVVDQFHWR 3OXVKRXUVLQKXPDQUHVRXUFHPDQDJHPHQWPDMRULQFOXGLQJ +,WK&HQWXU\:RUOG+LVWRU\, 0*7HDPZRUNDQG7HDPEXLOGLQJ +,WK&HQWXU\:RUOG+LVWRU\,, 0*2UJDQL]DWLRQDO'HYHORSPHQW +, +LVWRULFDO0HWKRGVDQG3XEOLF+LVWRU\ &$6PDOO*URXS&RPPXQLFDWLRQ HI 498 Seminar: Senior Capstone Experience 3<6RFLDO3V\FKRORJ\ 62&XOWXUDO'LYHUVLW\ one of the following: 3OXVVHPHVWHUKRXUVRIPDQDJHPHQWHOHFWLYHV +,+LVWRU\RIWKH0LGGOH(DVW +,+LVWRU\RI$VLD +,+LVWRU\RI/DWLQ$PHULFD Information Technology (IT) Assistant Professor J. Crites +,+LVWRU\RI5XVVLDDQGWKH6RYLHW8QLRQ, +,+LVWRU\RI5XVVLDDQGWKH6RYLHW8QLRQ,, and four additional courses at least two of which must be at the Success in business, organizations, and education today is depen- dent upon timely and correct information. Information technol- OHYHORUDERYH ogy professionals are responsible for meeting this need. Students The History Minor requires 18 credit hours, including: pursuing a degree in IT learn to harness the power of information +,86+LVWRU\WR WHFKQRORJ\WRFUHDWHLQIRUPDWLRQV\VWHPVWRVROYHSUREOHPVDQG - +,(XURSHDQ+LVWRU\IURPWKH5HQDLVVDQFHWR FUHDWHFRPSHWLWLYHDGYDQWDJH7KHPDMRUVLQ,QIRUPDWLRQ7HFK - HI 341 20th&HQWXU\:RUOG+LVWRU\, QRORJ\SUHSDUHVWXGHQWVIRUH[LVWLQJDQGHPHUJLQJMREVDQGFDU riers in the application of information systems and technology to HI 342 20th&HQWXU\:RUOG+LVWRU\,, One of the following: plan, analyze, design, construct, maintain, and manage computer systems and applications. +,+LVWRU\RIWKH0LGGOH(DVW +,+LVWRU\RI$VLD +,+LVWRU\RI/DWLQ$PHULFD 7KHPDMRUUHTXLUHVKRXUVRIFRUH,QIRUPDWLRQ7HFKQRORJ\ courses, including: +,+LVWRU\RI5XVVLDDQGWKH6RYLHW8QLRQ, +,+LVWRU\RI5XVVLDQDQGWKH6RYLHW8QLRQ,, ,7 3URJUDPPLQJ, $QGRQHDGGLWLRQDO+LVWRU\FRXUVHDWWKHOHYHORUKLJKHU ,7 3URJUDPPLQJ,, ,7 'DWDEDVH0DQDJHPHQW ,7 :HE%DVHG3URJUDPPLQJ Human Resource Management ,7 6RIWZDUH,QWHJUDWLRQ Course requirements for the Human Resource Management ,7 $OJRULWKPVDQG'DWD6WUXFWXUHV 0DMRUHPSKDVL]HQRWRQO\EXVLQHVVUHODWHGDUHDV PDQDJHPHQW ,7 1HWZRUN)XQGDPHQWDOV VWUDWHJLFSODQQLQJHWF EXWRWKHUDUHDVRILPSRUWDQFHIRUWKHKX- ,7 ,QIRUPDWLRQ7HFKQRORJ\(WKLFV PDQUHVRXUFHSURIHVVLRQDOVXFKDVFXOWXUDOGLYHUVLW\DQGUHOHYDQW ,7 +XPDQ&RPSXWHU,QWHUDFWLRQ psychology issues. ,7 &DSVWRQH6RIWZDUH(QJLQHHULQJ 7KH+XPDQ5HVRXUFH0DQDJHPHQW0DMRUUHTXLUHVVHPHVWHU In addition, one of the following three tracks must be completed: hours in the business core including: $&)LQDQFLDO$FFRXQWLQJ Business Track - for the student wishing to pursue a career in $&0DQDJHULDO$FFRXQWLQJ business %$4XDQWLWDWLYH%XVLQHVV$QDO\VLV $&3ULQFLSOHVRI$FFRXQWLQJ, %$%XVLQHVV6WDWLVWLFV $& 0DQDJHULDO$FFRXQWLQJ %$%XVLQHVV&RPPXQLFDWLRQ %$ %XVLQHVV6WDWLVWLFV %$%XVLQHVV(WKLFV %$ %XVLQHVV&RPPXQLFDWLRQ %$%XVLQHVV/DZ (& 0LFURHFRQRPLFV %$ %XVLQHVV3ROLF\ 0*3ULQFLSOHVRI0DQDJHPHQW (&0LFURHFRQRPLFV 0.3ULQFLSOHVRI0DUNHWLQJ (&0DFURHFRQRPLFV ),%XVLQHVV)LQDQFH Math Track - for the student wishing to work in software engi- ,76SUHDGVKHHWV neering or pursue graduate work 0*3ULQFLSOHVRI0DQDJHPHQW 0$$QDO\WLFDO*HRPHWU\ &DOFXOXV, 0*+XPDQ5HVRXUFH0DQDJHPHQW 0$$QDO\WLFDO*HRPHWU\ &DOFXOXV,, Majors & Requirements 41 0$/LQHDU$OJHEUD (1%ULWLVK/LWHUDWXUH 0$'LVFUHWH0DWKHPDWLFDO6WUXFWXUHV (1%ULWLVK/LWHUDWXUH 0$3UREDELOLW\ 6WDWLVWLFV *6*UDPPDU 0$2SHUDWLRQV5HVHDUFK *66SHOOLQJ *69RFDEXODU\ $PLQRULQ,QIRUPDWLRQ7HFKQRORJ\LVDYDLODEOHWRSUHSDUH Plus VWXGHQWVWRXWLOL]HLQIRUPDWLRQWHFKQRORJ\LQWKHLUPDMRUDUHDRI ('3KRQLFV study. Students must successfully complete 21 hours of the fol- (',QVWUXFWLRQDO7HFKQRORJ\ lowing: (')RXQGDWLRQVRI$PHULFDQ3XEOLF(GXFDWLRQ ,7 3URJUDPPLQJ, ('(GXFDWLRQRI([FHSWLRQDO&KLOGUHQ ,7 'DWDEDVH0DQDJHPHQW (' (GXFDWLRQDO3V\FKRORJ\ ,7 :HEEDVHG3URJUDPPLQJ ('7HDFKLQJ6HFRQGDU\6WXGHQWV ,7 6RIWZDUH,QWHJUDWLRQ ('6HFRQGDU\3UDFWLFXP ,7 ,QIRUPDWLRQ7HFKQRORJ\(WKLFV (' $GYDQFHG)LHOG([SHULHQFH Plus 6 hours of any other IT classes higher than IT110 (',QWHUQVKLSLQ$GROHVFHQW Integrated Social Studies ORJ7KHPDMRUUHTXLUHV 7KLVPDMRUOHDGVWROLFHQVXUHWRWHDFKVRFLDOVWXGLHVLQJUDGHV 7 - 12. Admission to the Teacher Education Program and other %,%RWDQ\ requirements are discussed in the Education section of the cata- %, =RRORJ\ ORJ7KHPDMRUUHTXLUHV %,)LHOG=RRORJ\ %,)LHOG%RWDQ\ (&0LFURHFRQRPLFV %,&RPSDUDWLYH9HUWHEUDWH$QDWRP\ (&0DFURHFRQRPLFV %,(FRORJ\ *(*HRJUDSK\RIWKH$PHULFDV %,5HVWRUDWLRQ(FRORJ\ *(:RUOG*HRJUDSK\ %,*HQHWLFV +,86+LVWRU\WR &+*HQHUDO&KHPLVWU\, +,(XURSHDQ+LVWRU\IURPWKH5HQDLVVDQFHWR &+*HQHUDO&KHPLVWU\,, +,WK&HQWXU\:RUOG, 0$3UHFDOFXOXV0DWK +,WK&HQWXU\:RUOG,, 16 1DWXUDO6FLHQFH6HPLQDU one nonwestern history course chosen from: 16 6HQLRU&DSVWRQH([SHULHQFH +,+LVWRU\RIWKH0LGGOH(DVW 3+,QWURGXFWLRQWR*HRORJ\ +,+LVWRU\RI$VLD 3+*HQHUDO3K\VLFV, +,+LVWRU\RI/DWLQ$PHULFD 3<%HKDYLRUDO6WDWLVWLFV +,+LVWRU\RI5XVVLDDQGWKH6RYLHW8QLRQ, ('6FLHQFH0HWKRGV *UDGHV± +,+LVWRU\RI5XVVLDDQGWKH6RYLHW8QLRQ,, Plus +,2KLR$UHD (',QVWUXFWLRQDO7HFKQRORJ\ +, +LVWRULFDO0HWKRGV 3XEOLF+LVWRU\ (')RXQGDWLRQVRI$PHULFDQ3XEOLF(GXFDWLRQ +, 6HQLRU&DSVWRQH([SHULHQFH ('(GXFDWLRQRI([FHSWLRQDO&KLOGUHQ 36$PHULFDQ1DWLRQDO*RYHUQPHQW (' (GXFDWLRQDO3V\FKRORJ\ 36$PHULFDQ6WDWHDQG/RFDO*RYHUQPHQW ('5HDGLQJLQWKH&RQWHQW)LHOG 3<,QWURGXFWLRQWR3V\FKRORJ\ ('7HDFKLQJ6HFRQGDU\6WXGHQWV 3<$GROHVFHQFHDQG$GXOWKRRG ('6HFRQGDU\3UDFWLFXP 626RFLDO3UREOHPV (',QWHUQVKLSLQ$GROHVFHQW 16 6HQLRU&DSVWRQH([SHULHQFH 3+,QWURGXFWLRQWR*HRORJ\ 3OXVVHPHVWHUKRXUVLQWKHPDMRUFRUHLQFOXGLQJ 3+*HQHUDO3K\VLFV, 0*7HDPZRUNDQG7HDPEXLOGLQJ 3<%HKDYLRUDO6WDWLVWLFV 0**OREDO,VVXHVLQ0DQDJHPHQW ('6FLHQFH0HWKRGV *UDGHVWR 0*6HPLQDULQ0DQDJHPHQW Plus 0*2UJDQL]DWLRQDO/HDGHUVKLS (',QVWUXFWLRQDO7HFKQRORJ\ 0*6PDOO%XVLQHVV0DQDJHPHQW 25 (')RXQGDWLRQVRI$PHULFDQ3XEOLF(GXFDWLRQ 0*2UJDQL]DWLRQDO'HYHORSPHQW ('(GXFDWLRQRI([FHSWLRQDO&KLOGUHQ 0* &XUUHQW7UHQGVLQ0DQDJHPHQW (' (GXFDWLRQDO3V\FKRORJ\ ('5HDGLQJLQWKH&RQWHQW)LHOG 7KHPDQDJHPHQWPLQRULVGHVLJQHGWRSURYLGHUHOHYDQWFRXUVHVWR ('7HDFKLQJ6HFRQGDU\6WXGHQWV VWXGHQWVZKRVHPDMRUVDUHLQDQRWKHUGHSDUWPHQWVXFKDV&ULPL- ('6HFRQGDU\3UDFWLFXP nal Justice, Social Work, Communication Arts, Religion, etc. and (' $GYDQFHG)LHOG([SHULHQFH who desire to acquire the fundamentals necessary to administer (',QWHUQVKLSLQ$GROHVFHQW students apply for 12 months of clinical experience in a hospital 7KHPDUNHWLQJPLQRULVGHVLJQHGWRSURYLGHUHOHYDQWFRXUVHV accredited for teaching medical technology, for which 30 credits WRVWXGHQWVZKRVHPDMRUVDUHLQDQRWKHUGHSDUWPHQWVXFKDV ZLOOEHJUDQWHG$FFHSWDQFHE\KRVSLWDOVLVFRPSHWLWLYHDQG Criminal Justice, Social Work, Communication Arts, Religion, cannot be guaranteed. The baccalaureate degree will be awarded etc., and who desire to acquire the fundamentals of the marketing on successful completion of the hospital program, and the student GLVFLSOLQH6WXGHQWVPDMRULQJLQRQHRIWKHEXVLQHVVDUHDVDUHQRW will then be eligible to take the medical technology registry eligible to earn a minor in marketing. examination. The marketing minor is 21 hours. Fifteen are required and are Course requirements include: GHVLJQHGWRIDPLOLDUL]HVWXGHQWVZLWKWKH¿QDQFLDOPDUNHWLQJDQG %,%RWDQ\ legal aspects of managing any kind of organization. They are: %, =RRORJ\ $&)LQDQFLDO$FFRXQWLQJ %,$QDWRP\DQG3K\VLRORJ\, $&0DQDJHULDO$FFRXQWLQJ %,$QDWRP\DQG3K\VLRORJ\,, 0.3ULQFLSOHVRI0DUNHWLQJ %,+LVWRORJ\ 0.$GYHUWLVLQJ %,%DFWHULRORJ\ %$%XVLQHVV/DZ %,,PPXQRORJ\ %,3DWKRJHQLF0LFURELRORJ\ 3OXVWZRFRXUVHVFKRVHQLQFRQVXOWDWLRQZLWKWKHDGYLVRUIURP &+*HQHUDO&KHPLVWU\, %$%XVLQHVV&RPPXQLFDWLRQ &+*HQHUDO&KHPLVWU\,, 0*3ULQFLSOHVRI0DQDJHPHQW &+2UJDQLF&KHPLVWU\, 0.6DOHVPDQVKLS &+2UJDQLF&KHPLVWU\,, 0. 0DUNHWLQJ5HVHDUFK &+4XDQWLWDWLYH$QDO\VLV 16 6HPLQDU FUHGLWVWRWDO 16 6HQLRU&DSVWRQH3URMHFW Mathematics (MA) 0$3UH&DOFXOXV0DWKHPDWLFV Assistant Professor D. Stuckey 3<%HKDYLRUDO6WDWLVWLFV and 3 credits in Information Technology 7KHPDWKHPDWLFVPDMRUUHTXLUHVVHPHVWHUKRXUVLQFOXGLQJ 0$3UH&DOFXOXV0DWKHPDWLFV LIQHHGHG 0$$QDO\WLFDO*HRPHWU\DQG&DOFXOXV, Multi-Media Communication 0$$QDO\WLFDO*HRPHWU\DQG&DOFXOXV,, Assistant Professor A. Drees 0$$QDO\WLFDO*HRPHWU\DQG&DOFXOXV,,, 0$/LQHDU$OJHEUD Organizational communication is becoming increasingly digital. 0$0RGHUQ$EVWUDFW$OJHEUD Desktop publishing, web sites, and digital capture and manipula- 0$0RGHUQ*HRPHWU\ WLRQRIDXGLRDQGYLVXDOLPDJHVDUHEHFRPLQJVWDQGDUGRSHUDWLRQV 0$ 6HQLRU&DSVWRQH3URMHFW RIPRVWRUJDQL]DWLRQV%\GHYHORSLQJVNLOOVLQRUDODQGZULW- $QGHLWKHU,73URJUDPPLQJ, RU3+*HQHUDO3K\VLFV WHQFRPPXQLFDWLRQPDUNHWLQJDQGDGYHUWLVLQJIXQGDPHQWDOV , $GGLWLRQDOFRXUVHV LIQHHGHG DUHVHOHFWHGIURP0$ DUWLVWLFJUDSKLFGHVLJQDQGGLJLWDOPHGLDWKLVPDMRUSUHSDUHVDQ FRXUVHVQXPEHUHGRUDERYH LQGLYLGXDOWREHFRPHDYDOXDEOHUHVRXUFHWRDSUR¿WRUQRQSUR¿W organization. The mathematics minor requires at least 18 semester hours including: 3UDFWLFXPVLQDYDULHW\RIPHGLDSURYLGHFRQWLQXRXVDSSOLFDWLRQ 0$$QDO\WLFDO*HRPHWU\DQG&DOFXOXV, DQGLPSURYHPHQWRIFRPPXQLFDWLRQVNLOOVZLWKDFXOPLQDWLQJ 0$$QDO\WLFDO*HRPHWU\DQG&DOFXOXV,, experience in an internship. 0$/LQHDU$OJHEUD RU 0$0RGHUQ$EVWUDFW$OJHEUD 7KH0XOWL0HGLD&RPPXQLFDWLRQPDMRUUHTXLUHVVHPHVWHU 6 additional credits are selected from MA courses numbered 200 hours, including: RUDERYH $5&RORUDQG'HVLJQ, $5*UDSKLF'HVLJQ3ULQFLSOHV $5%DVLF&RPSXWHU'HVLJQ Medical Technology $5,QWHUPHGLDWH*UDSKLF'HVLJQ This is a 3+1 baccalaureate program in medical technology. $5'UDZLQJ 7KH¿UVWWKUHH\HDUVWDNHQDW'H¿DQFH&ROOHJHLQFOXGHJHQHUDO $53KRWRJUDSK\ education requirements, 22 credits in biology and 23 credits %$%XVLQHVV&RPPXQLFDWLRQ in chemistry, for a minimum of 90 credits. The fourth year 0.3ULQFLSOHVRI0DUNHWLQJ Majors & Requirements 45 0.$GYHUWLVLQJ VWDQGDORQHPDMRU &$0HGLD&RPPXQLFDWLRQ &$6PDOO*URXS&RPPXQLFDWLRQ The program totals 36 semester hours including: &$&RPPXQLFDWLRQ7KHRU\ $&)LQDQFLDO$FFRXQWLQJ &$0DVV&RPPXQLFDWLRQ $&0DQDJHULDO$FFRXQWLQJ &$:HE'HVLJQ %$%XVLQHVV(WKLFV &$$XGLRDQG9LGHR3URGXFWLRQ (&0LFURHFRQRPLFV &$'$QLPDWLRQ 0*3ULQFLSOHVRI0DQDJHPHQW &$0XOWL0HGLD$XWKRULQJ, 0*+XPDQ5HVRXUFH0DQDJHPHQW &$2UJDQL]DWLRQDO&RPPXQLFDWLRQV 0*7HDPZRUNDQG7HDPEXLOGLQJ &$ ,QWHUQVKLS 0.3ULQFLSOHVRI0DUNHWLQJ (1$GYDQFHG&RPSRVLWLRQ ,7'HVNWRS3XEOLVKLQJ One Communication course chosen from: &$0HGLD:ULWLQJ Music (MU) &$6PDOO*URXS&RPPXQLFDWLRQ 3URIHVVRU(PHULWXV&6PDOO$GMXQFWVWDII Two additional courses from the following list: 0*6HPLQDULQ0DQDJHPHQW Music plays an important role in our society and in enriching 0*2UJDQL]DWLRQDO/HDGHUVKLS HDFKRIRXUOLYHV$W'H¿DQFH&ROOHJHVWXGHQWVZLWKDQLQWHUHVW 0*6PDOO%XVLQHVV0DQDJHPHQW 25 in music may participate in one or more of the College’s 0*2UJDQL]DWLRQDO'HYHORSPHQW SHUIRUPLQJJURXSVRUVWXG\SHUIRUPDQFHSULYDWHO\7KH&KDPEHU 0* &XUUHQW7UHQGVLQ0DQDJHPHQW Singers and the College Community Band often perform on PY 310 Social Psychology campus, and the former group frequently performs off campus. 6HQLRU&DSVWRQH±%$ %XVLQHVV3ROLF\ 2U 1RPDMRURUPLQRULQPXVLFLVRIIHUHG $VWXGHQWGHVLJQHGSURMHFW%$ ,QGHSHQGHQW6WXG\ Natural Science (NS) Physical Education (PE) &RXUVHRIIHULQJVLQFOXGHVXSSRUWFRXUVHVIRUWKHVFLHQFHPDMRUV 7KLVPDMRUOHDGVWRDPXOWLDJHOLFHQVXUHWRWHDFK3K\VLFDO and general education courses. Education age 3 through grade 12. Admission to the Teacher Education Program and other requirements are discussed in the $QLQGLYLGXDOO\GHVLJQHGPDMRULQ1DWXUDO6FLHQFHLVDYDLODEOH (GXFDWLRQVHFWLRQRIWKLVFDWDORJ7KHPDMRUUHTXLUHV It requires 40 hours agreed upon by the student and the Natural Science faculty. The courses can be chosen entirely from within %,$QDWRP\DQG3K\VLRORJ\, natural science disciplines or can include courses offered in other %,$QDWRP\DQG3K\VLRORJ\,, GLVFLSOLQHV16 6HPLQDUDQG16 6HQLRU&DSVWRQH3URMHFW 3(6HFRQGDU\6FKRRO$FWLYLWLHV must be included as part of the student’s program. A pre-designed 3()RXQGDWLRQVRI+HDOWK3K\VLFDO(GXFDWLRQDQG6SRUW &KHPLVWU\HPSKDVLVLVDYDLODEOHDVD1DWXUDO6FLHQFHPDMRUDQG 3(3UH.*UDGH)LHOG3ODFHPHQW is described under Chemistry. 3(+HDOWKDQG3K\VLFDO$FWLYLWLHVIRU3UH. 3((YDOXDWLRQDQG0HDVXUHPHQWLQ+HDOWK 3K\VLFDO(GX- Organizational Leadership and FDWLRQ 3( $GDSWHG3K\VLFDO(GXFDWLRQ5HFUHDWLRQDQG6SRUW Supervision 3(3K\VLFDO(GXFDWLRQLQ*UDGHV $PDMRULQ2UJDQL]DWLRQDO/HDGHUVKLSDQG6XSHUYLVLRQLV 3()LHOG3ODFHPHQW DYDLODEOHRQO\DVDFRPSOHWLRQSURJUDPIRULQGLYLGXDOVKROGLQJ 3(6HFRQGDU\3K\VLFDO(GXFDWLRQ0HWKRGV DQ$VVRFLDWH'HJUHHLQD7HFKQRORJ\,WLVQRWDYDLODEOHDVD 3(([HUFLVH3K\VLRORJ\ 3(.LQHVLRORJ\DQG%LRPHFKDQLFV 3(0RWRU/HDUQLQJ 0RYHPHQW(GXFDWLRQ 3(3ULQFLSOHVRI&RDFKLQJ one coaching methods course chosen from: 3(0HWKRGVLQ&RDFKLQJ7UDFN 3(0HWKRGVLQ&RDFKLQJ%DVNHWEDOO 3(0HWKRGVLQ&RDFKLQJ6RIWEDOO 3(0HWKRGVLQ&RDFKLQJ%DVHEDOO Majors & Requirements 46 3(0HWKRGVLQ&RDFKLQJ)RRWEDOO plus 9 credit hours selected from: 3(0HWKRGVLQ&RDFKLQJ9ROOH\EDOO 3<$GROHVFHQFHDQG$GXOWKRRG 3(3UDFWLFDO$SSOLFDWLRQLQ&RDFKLQJ 3<6RFLDO3V\FKRORJ\ PE 481 Organization and Administration of Health, Physical 3<7HVWDQG0HDVXUHPHQWV (GXFDWLRQDQG6SRUW 3<3V\FKRELRORJ\ Plus (',QVWUXFWLRQDO7HFKQRORJ\ The psychology minor requires 21 credit hours including: (')RXQGDWLRQVRI$PHULFDQ3XEOLF(GXFDWLRQ 3<,QWURGXFWLRQWR3V\FKRORJ\ ('(GXFDWLRQRI([FHSWLRQDO&KLOGUHQ 3< +LVWRU\DQG6\VWHPVRI3V\FKRORJ\ (' (GXFDWLRQDO3V\FKRORJ\ 3<,QIDQF\DQG&KLOGKRRG ('5HDGLQJLQWKH&RQWHQW)LHOG 3<%HKDYLRUDO6WDWLVWLFV ('7HDFKLQJ6HFRQGDU\6WXGHQWV 3<5HVHDUFK0HWKRGV (',QWHUQVKLSLQ3UH.WR*UDGH SOXVFUHGLWKRXUVRI3V\FKRORJ\HOHFWLYHVRQHRIZKLFKPXVWEH (' ,QWHUQVKLS6HPLQDU DWWKHOHYHO 3(&RPPXQLW\)LUVW$LGDQG&35 3<,QIDQF\DQG&KLOGKRRG 3<$GROHVFHQWDQG$GXOWKRRG Recreation A minor program in Recreation is offered in the Sport Science area. Requirements total 18 to 19 hours and include: Physics (PH) 3(6HFRQGDU\6FKRRO$FWLYLWLHV Assistant Professor M. Studer 3(&DPS&RXQVHOLQJDQG$GPLQLVWUDWLRQ 3K\VLFVLVDVHUYLFHDUHD1RPDMRURUPLQRULVRIIHUHG 3( 5HFUHDWLRQ7KHRU\DQG/HDGHUVKLS 3(5HFUHDWLRQIRU6SHFLDO3RSXODWLRQV 3(&RPPXQLW\)LUVW$LGDQG&35 Political Science (PS) 3(5HFUHDWLRQ3URJUDPPLQJDQG$GPLQLVWUDWLRQ $GMXQFW6WDII and one course chosen from: 3ROLWLFDOVFLHQFHLVDVHUYLFHDUHD1RPDMRURUPLQRULVRIIHUHG PE 259 Adapted Physical Education, Recreation, and Remedial ([HUFLVH Psychology (PY) 3(3K\VLFDO(GXFDWLRQLQWKH(OHPHQWDU\6FKRRO Associate Professors F. Sanders and D. Dalke 3(3ULQFLSOHVRI&RDFKLQJ PE 481 Organization and Administration of Physical Education, Psychology is a science and a profession. Courses in psychology +HDOWKDQG5HFUHDWLRQ DUHLQWHQGHG WRFRQWULEXWHWRZDUGEHWWHUSHUVRQDODQGVRFLDO DGMXVWPHQWE\HQKDQFLQJVWXGHQWV¶XQGHUVWDQGLQJRIWKHPVHOYHV Religious Studies, Religious Education DQGRWKHUV WRSUHSDUHVWXGHQWVIRUJUDGXDWHVWXG\OHDGLQJ WRFDUHHUVLQWKH¿HOGRISV\FKRORJ\ WRSURYLGHDEDVLVIRU and Christian Education SUHSURIHVVLRQDOVWXG\ DVLQSUHODZSUHPHGLFDODQGUHODWHG Professor K. Christiansen, Asst. Professor M. Plant FDUHHUV WRSURYLGHDQXQGHUVWDQGLQJRISV\FKRORJLFDO principles, theories and techniques that will result in more 7KHUHDUHWZRPDMRUSURJUDPVLQWKHVWXG\RIUHOLJLRQ 5HOLJLRXV HIIHFWLYHIXQFWLRQLQJLQYDULRXVYRFDWLRQDO¿HOGVVXFKDV Studies and Christian Education. While the two programs EXVLQHVVHGXFDWLRQFULPLQDOMXVWLFHDQGVRFLDOZRUN DQG WR share many courses in common, they are designed to meet contribute to the students’ general cultural enrichment. different needs. The program in Religious Studies is designed WRSURPRWHWKHXQGHUVWDQGLQJRIUHOLJLRXVLGHDVYDOXHVDQG 7KHSV\FKRORJ\PDMRUUHTXLUHV FUHGLWKRXUVLQFOXGLQJ practices especially within Christianity as well as those of 3<,QWURGXFWLRQWR3V\FKRORJ\ UHOLJLRXVFRPPXQLWLHVIURPDOORYHUWKHZRUOG7KHSURIHVVRUV 3< +LVWRU\DQG6\VWHPVRI3V\FKRORJ\ encourage open inquiry, dialogue, and sharing in an ecumenical 3<,QIDQF\DQG&KLOGKRRG &KULVWLDQHQYLURQPHQWWKDWYDOXHVSHRSOHIURPGLIIHUHQWUHOLJLRXV 3<%HKDYLRUDO6WDWLVWLFV and cultural traditions. The program in Christian Education is 3< $EQRUPDO3V\FKRORJ\ GHVLJQHGWRSURYLGHDEDODQFHRIWKHRU\DQGSUDFWLFHLQFOXGLQJ 3<5HVHDUFK0HWKRGV hands-on learning experiences that will help students to work 3<([SHULPHQWDO3V\FKRORJ\ with children, youth, and adults in many kinds of educational 3<7KHRULHVRI3HUVRQDOLW\ PLQLVWULHV%RWKPDMRUVPHHWWKHQHHGVRIVWXGHQWVZKRDUH 3<0HPRU\DQG&RJQLWLRQ VHHNLQJWRGHYHORSWKHLURZQSHUVRQDODQGVSLULWXDOHQULFKPHQW 3< 6HQLRU6HPLQDU %RWKPDMRUVDOVRGHYHORSSHUVRQDODQGDQDO\WLFDOVNLOOVWKDW Majors & Requirements 47 HQKDQFHRQH¶VVXFFHVVLQPDQ\¿HOGVRIHQGHDYRULQFOXGLQJ 5/ &KXUFKDQG6HUYLFH/HDUQLQJ PLQLVWU\WHDFKLQJDQGKXPDQVHUYLFHSURIHVVLRQV 5/ 5HOLJLRQ6HPLQDU KUVSHUVHPHVWHUWRWDORIKRXUV 5/,QWURGXFWLRQWRWKH+HEUHZ%LEOH Students who are considering ministry or graduate study in 5/7HDFKLQJVRI-HVXVDQG/LIHRIWKH(DUO\&KXUFK UHOLJLRQ¿QGWKDWWKHPDMRULQUHOLJLRXVVWXGLHVSURYLGHVSUDFWLFDO 5/&XUULFXOXP7KHRU\DQG5HVRXUFHV SUHSDUDWLRQWKURXJKDQH[FHOOHQWRYHUYLHZRILPSRUWDQWPHWKRGV 5/(WKLFVDQG0RUDOV DQGDUHDVRIVWXG\LQWKH¿HOG6WXGHQWVZKRDUHWKLQNLQJRI 5/5HOLJLRQVRIWKH(DVW attending seminary should consult with the faculty in religious 5//HDGHUVKLSDQG*URXS:RUN7KHRU\ VWXGLHVIRUSODQQLQJWRDFKLHYHWKHLUSHUVRQDOJRDOV 5/)RUPLQJ2QH¶V)DLWK 5/:RPHQDQG0HQWKURXJKWKH+LVWRU\RI&KULVWLDQLW\ The major in Religious Studies totals 36 hours, including: 5/ )LHOG([SHULHQFH KRXUV 5/ 6HUYLFH/HDUQLQJ &KXUFK/LIHDQG/HDGHUVKLS 5/$GPLQLVWUDWLYH3ROLFLHVDQG3UDFWLFHV 5/ 6HPLQDULQ5HOLJLRXV6WXGLHV WRWDORIKRXUV 5/ )LHOG([SHULHQFH KRXUV 5/$SSURDFKHVWR5HOLJLRQ 3<,QIDQF\DQG&KLOGKRRG 5/,QWURGXFWLRQWRWKH+HEUHZ%LEOH 3<$GROHVFHQFHDQG$GXOWKRRG 5/7HDFKLQJRI-HVXVDQG/LIHRIWKH(DUO\&KXUFK 5/7KH%ODFN&KXUFKLQ$PHULFD Optional courses include: 5/(WKLFVDQG0RUDOV RL 110 Spirituality and Wholeness 5/5HOLJLRQVRIWKH(DVW 5/ &KXUFKDQG6HUYLFH/HDUQLQJ KUVHPHVWHUPD[LPXP 5/)RUPLQJ2QH¶V)DLWK DFFXPXODWLRQKRXUV 5/:RPHQDQG0HQWKURXJKWKH+LVWRU\RI&KULVWLDQLW\ 5/ 6HPLQDULQ5HOLJLRXV6WXGLHV KUVHPHVWHU PD[LPXP 5/ 6HQLRU&DSVWRQH DFFXPXODWLRQKRXUV 5/$SSURDFKHVWR5HOLJLRQ Optional courses include: 5/7KH%ODFN&KXUFKLQ$PHULFD 5/6SLULWXDOLW\DQG:KROHQHVV 5/ 6SHFLDO7RSLFV 5/)RXQGDWLRQVRI5HOLJLRXV(GXFDWLRQ 5/(IIHFWLYH,QYROYHPHQWRIWKH/DLW\ Requirements for the minor in Christian Education total 21 5/&XUULFXOXP7KHRU\DQG5HVRXUFHV hours of study selected from the courses required for a Christian 5//HDGHUVKLSDQG*URXS:RUN7KHRU\ (GXFDWLRQPDMRUDQGLQFOXGLQJ5/)RXQGDWLRQVRI5HOLJLRXV 5/ 6SHFLDO7RSLFV (GXFDWLRQ 5/+HEUHZ%LEOH 5/7HDFKLQJVRI 5/$GPLQLVWUDWLYH3ROLFLHVDQG3UDFWLFHV -HVXVDQG/LIHRIWKH(DUO\&KXUFK DQGKRXUVRI5/ 6HUYLFH/HDUQLQJRU5/ )LHOG([SHULHQFH 7KHDGGLWLRQDO The minor in religious studies totals 18 hours, including: 9 credit hours are to be selected from the courses in the Christian 5/,QWURGXFWLRQWRWKH+HEUHZ%LEOH (GXFDWLRQPDMRULQFRQVXOWDWLRQZLWKWKH5HOLJLRQDQG&KULVWLDQ 5/7HDFKLQJRI-HVXVDQG/LIHRIWKH(DUO\&KXUFK Education faculty. 5/5HOLJLRQVRIWKH(DVW 5/:RPHQDQG0HQWKURXJKWKH+LVWRU\RI&KULVWLDQLW\ Religious Education and Design for Leadership DQGKRXUVRIHOHFWLYHVFKRVHQIURPWKH5HOLJLRQ6WXGLHVRU All programs of the Design for Leadership are described in detail &KULVWLDQ(GXFDWLRQPDMRUOLVWLQJV LQDVHSDUDWHFDWDORJDYDLODEOHE\ZULWLQJWKHIROORZLQJDGGUHVV &RRUGLQDWRURIWKH'HVLJQIRU/HDGHUVKLS'H¿DQFH&ROOHJH 0DMRUVDQGPLQRUVLQ&KULVWLDQ(GXFDWLRQDUHGHVLJQHGWRPHHW 1&OLQWRQ6W'H¿DQFH2+RUE\VHQGLQJDQHPDLO the needs of students with strong interest to pursue practical request to GHVLJQ#GH¿DQFHHGX. ministry as religious educators, youth workers, or mission workers, either upon graduation or during their course of study. The Design for Leadership is a Distance Learning program 6WXGHQWVLQWKHSURJUDPVKRXOGEHFRPHDFWLYHO\LQYROYHGLQ FUHDWHGLQ WRVHUYHSHUVRQVZKRVHHNDFDUHHULQUHOLJLRXV church life. education, but whose geographical location makes it impossible IRUWKHPWRSXUVXHVWXGLHVLQDFROOHJHRIIHULQJDPDMRULQ 5HTXLUHPHQWVIRUWKHPDMRULQ&KULVWLDQ(GXFDWLRQWRWDOKRXUV UHOLJLRXVHGXFDWLRQ7KH'HVLJQIRU/HDGHUVKLSDOVRVHUYHV RIFRXUVHZRUNSOXVKRXUVRI¿HOGZRUN6WXGHQWVPDMRULQJLQ persons already employed in religious education, but needing Christian Education are required to take the following courses: formal education in the profession. Most students in the Design IRU/HDGHUVKLSDUHUHHQWU\RUQRQWUDGLWLRQDOVWXGHQWV WKDWLV 5/)RXQGDWLRQVRI5HOLJLRXV(GXFDWLRQ they are beyond the traditional college age of 18-25. 5/(IIHFWLYH,QYROYHPHQWRIWKH/DLW\ The program was initiated and continues to be supported by the Majors & Requirements 48 6FKDXIÀHU(QGRZPHQW)XQGVIURPWKH8QLWHG&KXUFK&RXQFLO '/0RGHOVRI5HOLJLRXV(GXFDWLRQ RQ+LJKHU(GXFDWLRQDQGYDULRXVFKXUFKHVKDYHHQDEOHGWKH '/ 6SHFLDO7RSLFV SURJUDPWRPRYHEH\RQG2KLRDQGVHUYHVWXGHQWVDQ\ZKHUHLQ WKH8QLWHG6WDWHV&DQDGDRUWKH$UPHG)RUFHV*UDGXDWHV¿QG $WRWDORI KRXUVPXVWEHWDNHQLQWKHODVWWZRFDWHJRULHV employment in both part-time and full-time positions in churches or continue their studies in graduate institutions. 'HQRPLQDWLRQDO&HUWL¿FDWLRQLQ5HOLJLRXV(GXFDWLRQ &HUWL¿FDWLRQFULWHULDDUHHVWDEOLVKHGE\HDFKGHQRPLQDWLRQ)RU 7KH'HVLJQIRU/HDGHUVKLSRIIHUVERWKFHUWL¿FDWHDQGGHJUHH this reason it is important for the student to secure complete SURJUDPV&HUWL¿FDWHSURJUDPVDYDLODEOHLQFOXGHWKH&KXUFK information from his/her own denomination regarding the exact (GXFDWLRQ&HUWL¿FDWHWKH &KXUFK(GXFDWLRQ&HUWL¿FDWH Youth Ministry Leadership Module 7KH&KXUFK(GXFDWLRQ&HUWL¿FDWHLVFRPSRVHGRI*XLGHG 7KLVPRGXOHLVJHDUHGIRUSHUVRQVFXUUHQWO\DFWLYHLQ\RXWK Independent Studies and on-line courses that are completed in PLQLVWU\RUPRWLYDWHGWRZDUGDFDUHHULQ\RXWKPLQLVWU\ZLWK one’s home and community. Each of the Guided Independent or without prior formal training. This collection of courses 6WXGLHVDQGRQOLQHFRXUVHVHPSOR\VDYDULHW\RIHGXFDWLRQDO FDQUHVXOWLQDFHUWL¿FDWHRIFRPSOHWLRQRIWKHPRGXOHDQGRU resources and approaches often including experiential learning SURJUHVVWRZDUGD&KXUFK(GXFDWLRQ&HUWL¿FDWHRUD%$RUDQ DQG¿HOGEDVHGDSSOLFDWLRQLQWKHVWXGHQW¶VORFDOH $$GHJUHH$QLQHKRXULQWURGXFWRU\PRGXOHDQGD¿IWHHQKRXU PLGPRGXOHDUHERWKDYDLODEOH7KHVHRSWLRQVDUHGHVFULEHGPRUH 7KHÀH[LELOLW\RIWKHFHUWL¿FDWHSURJUDPHQDEOHVDVWXGHQWWR completely in the Design for Leadership Catalog referenced at the select and complete only those Guided Independent Studies or beginning of this section. on-line courses needed to complement one’s education or to meet UHTXLUHPHQWVIRUGHQRPLQDWLRQDOFHUWL¿FDWLRQ&RXUVHVFRPSOHWHG The 9 hour introductory module includes: may also be applied toward a B.A. or A.A. degree without loss of '/D+RZWR7KLQN7KHRORJLFDOO\ credit. Completing the requisite 34 semester hours (see below) '/D,QWURGXFLQJ,QWURGXFWLRQWRWKH+HEUHZ%LEOH IRUPHUO\ earns WKH'H¿DQFH&ROOHJH&HUWL¿FDWHLQ&KXUFK(GXFDWLRQ 7KH%LEOH 2OG7HVWDPHQW '/D7KH/LIHDQG7HDFKLQJVRI-HVXV Basic Studies 18 hours '/$GROHVFHQW'HYHORSPHQWDQG(QYLURQPHQW '/)RXQGDWLRQVRI5HOLJLRXV(GXFDWLRQ '/ %XLOGLQJ(IIHFWLYH Bachelor of Arts Degree The Bachelor of Arts degree is comprised of 120 semester hours Majors & Requirements 49 DQGXVHVWKHFRXUVHVOLVWHGDERYHXQGHUWKH&KXUFK(GXFDWLRQ includes: &HUWL¿FDWH3URJUDP ZLWKVXEVWLWXWLRQVSRVVLEOHIURPWKHRWKHU %,%RWDQ\ FHUWL¿FDWHPRGXOHV IRUWKHPDMRUFRXUVHVFRXSOHGZLWKIRXU %, =RRORJ\ VHPHVWHUV VHPHVWHUKRXUV RIVXSHUYLVHG¿HOGH[SHULHQFHLQD %,)LHOG=RRORJ\ church or church related agency. %,)LHOG%RWDQ\ %,(FRORJ\ ,QDGGLWLRQWKHUHDUHWZRRWKHUHOHPHQWV 'H¿DQFH&ROOHJH¶V %,:LOGOLIH0DQDJHPHQW *HQHUDO(GXFDWLRQ5HTXLUHPHQWV OLVWHGHDUOLHULQWKLVFDWDORJ %,5HVWRUDWLRQ(FRORJ\, DQG HOHFWLYHFRXUVHV*HQHUDOGHJUHHUHTXLUHPHQWVDUH %,5HVWRUDWLRQ(FRORJ\,, LGHQWL¿HGE\WKH'H¿DQFH&ROOHJHIDFXOW\EXWPD\EHWDNHQDW %,5HVWRUDWLRQ(FRORJ\,,, DORFDODFFUHGLWHGFROOHJHRUXQLYHUVLW\(OHFWLYHVPD\DOVREH &+*HQHUDO&KHPLVWU\, WDNHQWKURXJK'H¿DQFHRUDWORFDOLQVWLWXWLRQV$%DFKHORURI$UWV &+*HQHUDO&KHPLVWU\,, degree is necessary preparation for study at most seminaries and &+2UJDQLF&KHPLVWU\, all graduate schools of religion. It also constitutes a recognized 16 6HPLQDU WRWDORIFUHGLWV credential in denominational and local church settings, NS 499 Senior Capstone SDUWLFXODUO\LIWKHPDMRULVLQ&KULVWLDQ(GXFDWLRQ DQLQWHUQVKLSFRRSHUDWLYHHGXFDWLRQRU¿HOGH[SHULHQFH 0$3UH&DOFXOXV0DWKHPDWLFV Associate of Arts Degree 3< %HKDYLRUDO6WDWLVWLFV The Associate of Arts degree in Religious Education requires and 3 credits in Information Technology 61 credits or semester hours. Thirty-four of those semester KRXUVDUHLQFOXGHGDVWKHPDMRUXVLQJFRXUVHVQRWHGLQWKH &KXUFK(GXFDWLRQ&HUWL¿FDWH3URJUDP,QDGGLWLRQWKHUHDUHQLQH Social Work (SW) - VHPHVWHUKRXUVRIVXSHUYLVHG¿HOGH[SHULHQFH DFKLHYHGRYHU /3RZHOO6RFLDO:RUN3URJUDP'LUHFWRU 3URIHVVRUV&+RE - WKUHHVHPHVWHUV DQGKRXUVRIJHQHUDOGHJUHHUHTXLUHPHQWV JRRG-:HDQHU $VVRFLDWH3URIHVVRU)6DQGHUV $VVLVWDQW3UR The Associate of Arts degree is sought when a person feels that fessor and Field Director A. Yakos-Brown such a degree meets his or her needs at a particular stage of life. If one anticipates participation in graduate school, a Bachelor of Mission Statement: Arts degree is required. 7KH'H¿DQFH&ROOHJH6RFLDO:RUN3URJUDPVWULYHVWREHDOHDUQ- ing and nurturing community where the facets of students are de- Considerable additional information about the Design for YHORSHGWKURXJKVHOIUHÀHFWLRQDFDGHPLFVH[SHULHQWLDOOHDUQLQJ Leadership and its programs is included in the separate catalog DQGRSHQQHVV2XUDLPLVWRGHYHORSSURIHVVLRQDOJHQHUDOLVWVRFLDO referenced at the beginning of this section. ZRUNHUVZKRHPERG\WKHYDOXHVRIRXUSURIHVVLRQZKLOHVWULYLQJ to understand the complexity of people and their circumstances, and are dedicated to strengthening the communities, groups, and Restoration Ecology LQGLYLGXDOVWKDWFRPSULVHRXUGLYHUVHZRUOG7KHSURJUDPDOVR $VVRFLDWH3URIHVVRU'5HHG $VVW3URIHVVRU60DYURLGLV VWULYHVWRGHYHORSVHUYDQWOHDGHUVZKRVHHNWRHQULFKRSSRUWXQL- WLHVIRUWKHRSSUHVVHGDQGDUHDGYRFDWHVIRUVRFLDOMXVWLFH 7KLVSUDFWLFDODSSOLHGSURJUDPSUHSDUHVVWXGHQWVLQWKHUHODWLYHO\ QHZ¿HOGRIUHVWRUDWLRQHFRORJ\DQGLWDOVRSUHSDUHVVWXGHQWVIRU Program Goals: JUDGXDWHZRUNLQ¿VKHULHVELRORJ\ZLOGOLIHPDQDJHPHQWDQG 1. To prepare the student for immediate entry into ecology. HPSOR\PHQWLQDVRFLDOZRUN¿HOGDWWKHEHJLQQLQJ SUDFWLFHOHYHO 7KH5HVWRUDWLRQ(FRORJ\PDMRUUHTXLUHVVHPHVWHUKRXUVDQG 2. To prepare the student for licensure as a baccalaureate VRFLDOZRUNHU %6: LQWKHVWDWHRI2KLR 3. To prepare the student for graduate school education in VRFLDOZRUNE\JLYLQJWKHPDQDGHTXDWHIRXQGDWLRQLQ WKH¿YHFRPSRQHQWSDUWVRIRXUFXUULFXOXP VR- cial research, social welfare policy and GHOLYHU\KXPDQ EHKDYLRUDQGVRFLDO HQYLURQPHQWVRFLDOZRUNSUDFWLFH VNLOOVDQG¿HOGSUDFWLFXPLQDGGLWLRQWRFXUULFXOXP FRQWHQWLQYDOXHVHWKLFVGLYHUVLW\ VRFLDODQGHFRQRPLF MXVWLFHDQGSRSXODWLRQVDWULVN 4. To promote life-long learning and professional growth for students and area social work practitioners. Majors & Requirements 50 Program Admission Policies and Procedures: 6WXGHQWVZKRFKRVHWRPDMRULQVRFLDOZRUNPXVWPDNHIRUPDO Sociology (SO) application to the Social Work Program. Applications should be 6RFLRORJ\LVDVHUYLFHDUHD QRPDMRULVRIIHUHG7KHFRXUVH submitted to the Social Work Program Director by the Spring offerings in this area should be considered as cognate courses for VHPHVWHURIWKH6RSKRPRUH\HDU E\IDOORIWKH-XQLRU\HDUIRU VXFKDUHDVDVVRFLDOZRUNFULPLQDOMXVWLFHSUHODZKLVWRU\DQG WUDQVIHUVWXGHQWV WRHQVXUHWKHVHTXHQFLQJRIUHTXLUHGSUDFWLFH pre-theology. FRXUVHVDQG¿HOGSODFHPHQW Students must meet the following criteria in order to be accepted Spanish (SP) 6SDQLVKLVDVHUYLFHDUHD1RPDMRULVRIIHUHG IRUDGPLVVLRQWRWKH'H¿DQFH&ROOHJH6RFLDO:RUN3URJUDP +DYHDFXPXODWLYHJUDGHSRLQWDYHUDJHRIRUDERYH +DYHDFXPXODWLYHJUDGHSRLQWDYHUDJHRIRUDERYH Sport Management (SM) in Social Work courses completed in the pre-pro- 7KH6SRUW0DQDJHPHQW0DMRU FUHGLWV LVGHVLJQHGIRUWKH fessional sequence or permission of the LQGLYLGXDOSODQQLQJWRSXUVXHDFDUHHUDV UHFUHDWLRQOHDGHU Social Work Program Director. sporting goods retailer, professional team administrator, sports 3. Complete a written application. lawyer, sports psychologist, resort manager, golf course or 4. Submit a written autobiographical paper. country club manager. It is also appropriate for those considering 5. Submit three completed professional reference forms. careers as a sports consultant to businesses, churches, camps, etc. 3DUWLFLSDWHLQDQLQWHUYLHZZLWK6RFLDO:RUNIDFXOW\ and for those interested in employment as a sports information 5HDGWKH'H¿DQFH&ROOHJH6RFLDO:RUN3URJUDP6WX- GLUHFWRURUVSRUWVMRXUQDOLVW7KHSURJUDPLVGHVLJQHGWRSUHSDUH dent Handbook and agree to abide by its VWXGHQWVWRREWDLQHLWKHUDQHQWU\OHYHOSRVLWLRQXSRQJUDGXDWLRQ contents including the NASW Code of or to continue their studies in graduate school. Ethics, the Ohio Code of Ethical Practice and Professional Conduct, and the Policy for 7KH6SRUW0DQDJHPHQW0DMRU KRXUV LQFOXGHV Dismissal from the Program. 3()RXQGDWLRQVRI+HDOWK3K\VLFDO(GXFDWLRQDQG6SRUW +(&RPPXQLW\)LUVW$LGDQG&35 Course Requirements: SM 481 Organization and Adminstration of Health, Physical 7KH6RFLDO:RUNPDMRU FUHGLWV LQFOXGHVFUHGLWVLQVRFLDO (GXFDWLRQDQG6SRUW ZRUNFRXUVHVDQGFUHGLWVLQ¿HOGSODFHPHQW 62+LVWRU\RI6SRUWVLQWKH8QLWHG6WDWHV 6:,QWURGXFWLRQWR6RFLDO:RUN 626RFLRORJ\RI6SRUW 6:6RFLDO3UREOHPV 606SRUW0DQDJHPHQW 6:,QWHUYLHZLQJDQG,QWHUSHUVRQDO&RPPXQLFDWLRQ 60 )LHOG([SHULHQFH 6:5HVHDUFK0HWKRGV 60$GYDQFHG6SRUW0DQDJHPHQW 6:3UDFWLFH, *HQHUDOLVW3UDFWLFH 60 ,QWHUQVKLSZLWKFDSVWRQH 6:3UDFWLFH,, *URXSVDQG)DPLOLHV*HQHUDOLVW3UDFWLFH &$0HGLD:ULWLQJ 6: $SSOLHG%HKDYLRUDO6FLHQFH $&)LQDQFLDO$FFRXQWLQJ 6: )LHOG([SHULHQFH 0.3ULQFLSOHVRI0DUNHWLQJ 6:3UDFWLFH,,, 0DFUR6\VWHPV*HQHUDOLVW3UDFWLFH two courses chosen from: 6:6RFLDO:HOIDUHDQG3ROLF\'HYHORSPHQW &$,QWHUSHUVRQDO&RPPXQLFDWLRQ 6:6HQLRU6HPLQDU &$0DVV&RPPXQLFDWLRQV 6:)LHOG,QVWUXFWLRQ &$3XEOLF5HODWLRQV &$3HUVXDVLRQ The pre-professional sequence courses are prerequisites for up- &$2UJDQL]DWLRQDO&RPPXQLFDWLRQ SHUGLYLVLRQVRFLDOZRUNFRXUVHVDQGPXVWEHFRPSOHWHGSULRUWR &$3XEOLF$GYRFDF\ admission into the program. These courses are: and three courses chosen from: 3<,QWURGXFWLRQWR3V\FKRORJ\ $&0DQDJHULDO$FFRXQWLQJ 3< $EQRUPDO3V\FKRORJ\ 0*3ULQFLSOHVRI0DQDJHPHQW 3<,QIDQF\DQG&KLOGKRRG 0*+XPDQ5HVRXUFH0DQDJHPHQW 3<$GROHVFHQFHDQG$GXOWKRRG 0.$GYHUWLVLQJ 6:&XOWXUDO'LYHUVLW\ 0.6DOHVPDQVKLS 6:%HKDYLRUDO6WDWLVWLFV %$%XVLQHVV&RPPXQLFDWLRQ 6:/LIHLQ6RFLHW\ %$%XVLQHVV(WKLFV 6: 0DUULDJHDQG)DPLO\ %$%XVLQHVV/DZ Majors & Requirements 51 $5*UDSKLF'HVLJQ3ULQFLSOHV $PLQRULQ6SRUW0DQDJHPHQWLVDYDLODEOHWRWDOVKRXUVDQG $5'UDZLQJ includes: $5,QWURGXFWLRQWR3DLQWLQJ 3()RXQGDWLRQVRI+HDOWK3K\VLFDO(GXFDWLRQDQG6SRUW $5&HUDPLFV 60 )LHOG([SHULHQFH $53KRWRJUDSK\ +(&RPPXQLW\)LUVW$LGDQG&35 $5$UW+LVWRU\ SM 481 Organization and Administration of Physical Education $5$UW+LVWRU\, DQG6SRUW $5/LIH'UDZLQJ 606SRUW0DQDJHPHQW $56FXOSWXUH 60$GYDQFHG6SRUW0DQDJHPHQW $53ULQWPDNLQJ 62+LVWRU\RI6SRUWVLQWKH8QLWHG6WDWHV $5+LVWRU\RI$PHULFDQ$UW 626RFLRORJ\RI6SRUW sL[KRXUVRIHOHFWLYHVFKRVHQIURP $5%DVLF&RPSXWHU'HVLJQ Sport Science $5,QWHUPHGLDWH*UDSKLF'HVLJQ $VVRFLDWH3URIHVVRU75LFNDEDXJK $VVW3URIHVVRUV.7RQJ $5$GYDQFHG*UDSKLF'HVLJQ Lectures: R. Kaiser, C. Rutter, C. Donsbach, K. Kankey, D. $5$GYDQFHG'UDZLQJ Kwan, C. Studrawa, and K. Westfall $5$GYDQFHG3DLQWLQJ $5$GYDQFHG&HUDPLFV 6SRUW6FLHQFHSURJUDPPDMRUVLQFOXGH +HDOWK(GXFDWLRQ Plus: Physical Education, Sport Management, Wellness and Corporate (',QVWUXFWLRQDO7HFKQRORJ\ Fitness, and Athletic Training Education. (')RXQGDWLRQVRI(GXFDWLRQ ('(GXFDWLRQRI([FHSWLRQDO&KLOGUHQ (DFKRIWKHVHPDMRUVUHTXLUHVDVHQLRUFDSVWRQHH[SHULHQFH)RU (' (GXFDWLRQDO3V\FKRORJ\ WKRVHPDMRULQJLQ+HDOWK(GXFDWLRQDQG3K\VLFDO(GXFDWLRQ Licensure programs, Student Teaching and participation in the (' 0LGGOH&KLOGKRRG)LHOG([SHULHQFH 6WXGHQW7HDFKLQJ6HPLQDUPHHWWKLVUHTXLUHPHQW)RUWKHPDMRUV ED 340 Principles and Practices of Middle Childhood Education LQ6SRUW0DQDJHPHQW:HOOQHVVDQG&RUSRUDWH)LWQHVVDQG QRQ RU WHDFKLQJ +HDOWKDQG3K\VLFDO(GXFDWLRQSURJUDPVDVSHFL¿FDOO\ ('7HDFKLQJ6HFRQGDU\6WXGHQWV DQG selected internship will be required with a presentation to ('6HFRQGDU\3UDFWLFXP department faculty at the completion of the internship. Athletic 7UDLQLQJPDMRUVZLOOGHYHORSWKHLUFDSVWRQHH[SHULHQFHWKURXJK ('5HDGLQJLQWKH&RQWHQW)LHOG 3UDFWLFXP V9DQG9,6WXGHQWVPXVWKDYHD*3$LQWKH ('$UW0HWKRGV 3UH.± PDMRUEHIRUHUHJLVWHULQJIRUDQLQWHUQVKLS (',QWHUQVKLSLQ3UH.± (' ,QWHUQVKLS6HPLQDU ,QRUGHUIRU+HDOWK(GXFDWLRQDQG3K\VLFDO(GXFDWLRQPDMRUV 3<,QIDQF\DQG&KLOGKRRG the Licensure program to complete the capstone experience, 3<$GROHVFHQFHDQG$GXOWKRRG they MUST follow the requirements established by the Teacher 3(&RPPXQLW\)LUVW$LGDQG&35 Education Department. If there are questions concerning the process, contact the Head of Teacher Education. Minors in Recreation, Wellness and Corporate Fitness and Sport Wellness and Corporate Fitness (WE) Management are also offered. 7KH:HOOQHVVDQG&RUSRUDWH)LWQHVV0DMRU FUHGLWKRXUV LV GHVLJQHGIRULQGLYLGXDOVSXUVXLQJFDUHHUVLQFRUSRUDWH<0&$ Refer to the corresponding sections for course requirements. DQGFRPPXQLW\EDVHGZHOOQHVVDQG¿WQHVVSURJUDPVDQG Athletic Training Education. Visual Arts 5HTXLUHGFRXUVHVIRUWKH:HOOQHVVPDMRULQFOXGH 7KLVPDMRUOHDGVWRDPXOWLDJHOLFHQVXUHWRWHDFKYLVXDODUWV +(3HUVRQDODQG&RPPXQLW\+HDOWK pre-K through grade 12. Admission to the Teacher Education 3()RXQGDWLRQVRI+HDOWK3K\VLFDO(GXFDWLRQDQG6SRUW Program and other requirements are discussed in the Education VHFWLRQRIWKHFDWDORJ7KHPDMRUUHTXLUHV $5&RORUDQG'HVLJQ, $5&RORUDQG'HVLJQ,, Majors & Requirements 52 3(5HFUHDWLRQIRU6SHFLDO3RSXODWLRQV +(&RPPXQLW\)LUVW$LGDQG&35 +(([HUFLVH3K\VLRORJ\ %,+XPDQ$QDWRP\DQG3K\VLRORJ\,,, 6:+HDOWK&DUH,VVXHV :()LHOG([SHULHQFH :( :HOOQHVV3URJUDP,PSOHPHQWDWLRQ WE 481 Organization & Adminstration Health Physical (GXFDWLRQDQG6SRUW :( $GYDQFHG:HOOQHVV3URJUDP,PSOHPHQWDWLRQ :( ,QWHUQVKLS $73KDUPDFRORJ\ $71XWULWLRQ $PLQRULQ:HOOQHVVDQG&RUSRUDWH)LWQHVVLVDYDLODEOHUHTXLUHV 23 hours, and includes: %,+XPDQ$QDWRP\DQG3K\VLRORJ\, 3()RXQGDWLRQVRI+HDOWK3K\VLFDO(GXFDWLRQDQG6SRUW +(3HUVRQDODQG&RPPXQLW\+HDOWK 3(([HUFLVH3K\VLRORJ\ :( :HOOQHVV3URJUDP,PSOHPHQWDWLRQ :( $GYDQFHG:HOOQHVV3URJUDP,PSOHPHQWDWLRQ $73KDUPDFRORJ\ $71XWULWLRQ A Red Cross First Aid and CPR card should be secured by the student. Course Descriptions 53 Accounting ,QWURGXFWLRQWRDXGLWLQJDQGWKHSURIHVVLRQDOZRUNRI&3$V AC 221 Financial Accounting DXGLWLQJVWDQGDUGVDQGSURFHGXUHVHYDOXDWLRQRILQWHUQDOFRQWURO 6XUYH\RI¿QDQFLDODFFRXQWLQJDQGUHSRUWLQJIRUQRQ legal liability, ethics, and auditor opinions. Prerequisite or accountants: accounting terminology and concepts, tax and FRQFXUUHQW $&2IIHUHGLQHYHQDOWHUQDWH\HDUV SD\UROOUHTXLUHPHQWVLQWHUQDOFRQWUROVLQWHUSUHWDWLRQRI¿QDQFLDO VWDWHPHQWVSUHSDUHGE\EXVLQHVVDQGQRQSUR¿WRUJDQL]DWLRQV AC 495 Issues in Accounting 5HYLHZRIDFFRXQWLQJWKHRU\DQGSUDFWLFH)LQDQFLDO$FFRXQWLQJ AC 222 Managerial Accounting Standards Board statements will be emphasized along with Accounting information used for purposes of planning and current topics from tax accounting, cost accounting, accounting FRQWURO SURGXFWFRVWLQJEUHDNHYHQEXGJHWLQJSHUIRUPDQFH V\VWHPVDXGLWLQJDGYDQFHGDFFRXQWLQJ LQFOXGLQJQRQSUR¿W HYDOXDWLRQSULFLQJGHFLVLRQDQDO\VLV3UHUHTXLVLWH RQHVHPHVWHU DFFRXQWLQJ DQG&3$FRXUVHPDWHULDOV3UHUHTXLVLWH FUHGLWV of accounting. in accounting. AC 321,322 Intermediate Accounting I,II Arts and Humanities ,QGHSWKVWXG\RI¿QDQFLDODFFRXQWLQJDQGUHSRUWLQJHPSKDVL]LQJ AH 111 Global Civilization I ERWKSUDFWLFHDQGXQGHUO\LQJWKHRU\ UHYLHZRIWKHDFFRXQWLQJ $VWXG\RIJOREDOFLYLOL]DWLRQVIURPWKHHDUO\GHYHORSPHQWRI F\FOH FRQWURORIFDVKUHFHLYDEOHVDQGEDGGHEWV LQYHQWRU\ complex societies up to 1500. This course includes historical V\VWHPVDQGYDOXDWLRQ SD\UROODFFRXQWLQJ ¿[HGDVVHWV analysis of the organizing principles of societies in Asia, the GHSUHFLDWLRQDQGDPRUWL]DWLRQ ERQGVDQGQRWHVSD\DEOH Middle East, Africa, Europe, the Americas, and Oceania. FDSLWDOVWRFNDQGUHWDLQHGHDUQLQJV HDUQLQJVSHUVKDUH LQFRPH Included is the interdisciplinary study of politics, economics, WD[HV SHQVLRQV OHDVHV FDVKÀRZVWDWHPHQWV DQGUHSRUWLQJ religion, philosophy, art, literature, and music. requirements. Prerequisite: AC 222. Offered odd alternate years. AH 112 Global Civilization II AC 327 Federal Taxation $VWXG\RIJOREDOFLYLOL]DWLRQVIURPWRSUHVHQW)RFXVLQJ 6XUYH\RIIHGHUDOWD[DWLRQRILQGLYLGXDOVSURSULHWRUVKLSV on the human condition, this course includes historical analysis, partnerships and corporations focusing on basic concepts and as well as the study of art, literature, music, religion, philosophy, SULQFLSOHV WD[WUHDWPHQWRISHUVRQDODQGEXVLQHVVLQFRPHJDLQV DQG¿OP3UHUHTXLVLWHV 6XFFHVVIXOFRPSOHWLRQRI$+RU DQGORVVHVGHSUHFLDWLRQDQGRWKHUGHGXFWLRQV WD[SODQQLQJDQG permission of the instructor. introduction to tax research. Offered in the spring semester. AH 498 Liberal Arts Interdisciplinary Seminar AC 330 Cost Management (3) 7KHVWXGHQWZLOOGHYHORSDWRSLFRILQWHUHVWZKLFKZLOOUHTXLUH Study of cost-based decision making: product costing systems, cross-disciplinary critical thinking skills and/or research. The DFWLYLW\EDVHGFRVWLQJPDQDJHPHQWSURGXFWLYLW\DQGTXDOLW\ course may include presentations by outside speakers, faculty measurements, cost allocation, cost estimation and analysis, cost- members, and students with particular skills and knowledge YROXPHSUR¿WDQDO\VLVEXGJHWLQJDQG¿QDQFLDOFRQWUROV within the humanities and arts. AC 370 Accounting Information Systems An introduction to the common body of knowledge of accounting Art LQIRUPDWLRQV\VWHPV $,6 7KLVFRXUVH AR 111, 112 Color and Design I, II emphasizes the user of information systems approach with The elements of art and principals of design are explored: two- DQHPSKDVLVRQWKHUHVRXUFHVHYHQWVDJHQWV 5($ PRGHO dimensional in AR 111, three-dimensional in AR 112. The student will learn the terminology, reports, documents, procedures, and controls inherent in a modern AIS. AR 115 Graphic Design Principles (3) Principles of design including an introduction to design principles AC 400 Accounting Fundamentals (3) and theories. Includes elements of layout, typography, imagery, ,QWURGXFWRU\VXUYH\RIDFFRXQWLQJ¿QDQFLDOVWDWHPHQWVIRUERWK DQGYLVXDOFRPPXQLFDWLRQV3UHUHTXLVLWH $5,7 SUR¿WPDNLQJDQGQRQSUR¿WRUJDQL]DWLRQVWD[UHTXLUHPHQWV internal controls, cost analysis, cost accounting, budgeting, AR 210 Art Appreciation (3) decision analysis, accounting terms and concepts. Open only to Examines the role of the artist and art in the context of 0%2/VWXGHQWVZLWKRXWSUHYLRXVFRXUVHZRUNLQDFFRXQWLQJ FRQWHPSRUDU\DQGKLVWRULFDOO\VLJQL¿FDQWLVVXHV7KLVFRXUVH GHYHORSVWKHVWXGHQW¶VXQGHUVWDQGLQJRIDHVWKHWLFVDQGDUW AC 429 Auditing criticism. Included are in-studio explorations of the basic HOHPHQWVRIFUHDWLYHH[SUHVVLRQ'RHVQRWFRXQWWRZDUGDQDUWRU Course Descriptions 54 *UDSKLF'HVLJQPDMRU3UHUHTXLVLWH (1$+ &UHDWLYHH[SUHVVLRQWKURXJKSDLQWLQJ3UREOHPVLQDEVWUDFWDQG realistic painting worked out according to the interests of the AR 214 Basic Computer Design (3) LQGLYLGXDOVWXGHQW3UHUHTXLVLWH $50D\EHUHSHDWHG An introduction to the use of the computer as a tool in graphic design and illustration. Prerequisite: AR 115 AR 332 Sculpture (3) ([SORUDWLRQRIYDULRXVPHGLDLQFOXGLQJFOD\VWHHOVWRQHZRRG AR 215 Intermediate Graphic Design (3) and metal casting. Emphasis on three dimensional composition A computer-based course containing elements of design theory and personal interpretation. May be repeated. Prerequisite: AR DSSOLHGWRYLVXDOFRPPXQLFDWLRQDQGGHVLJQDSSOLHGWRSULQW 112 or permission of instructor. packaging and display. Prerequisite: AR 214 AR 341 2D Digital Animation (3) AR 221 Drawing (3) This course introduces the basic concepts of 2D digital 'HVLJQHGWRGHYHORSWKHVWXGHQW¶VDELOLW\WRPDNHDFFXUDWHYLVXDO animation. It focuses on web purposed animation including REVHUYDWLRQV6XEMHFWPDWWHUZLOOSURJUHVVIURPUHDOREMHFWV animated GIF and Flash technology. Physics will be addressed LQQDWXUDOVLWXDWLRQVWRWKHGHYHORSPHQWRIFRQFHSWXDOLPDJH but not emphasized. Prerequisites: IT100, AR214. Offered in PDNLQJ$ZLGHYDULHW\RIPHGLDZLOOEHH[SORUHGLQFOXGLQJ spring of odd alternate years. graphite, conte, ink, and wash. AR342 3D Digital Animation (3) AR 222 Introduction to Painting (3) This course introduces the basic concepts 3D digital animation. 6WXGLRSUREOHPVDVDEDVLVIRUVWXG\RIOLQHYDOXHDQGFRORU It focuses on the basics of modeling, skinning, bump mapping, 3UREOHPVGHVLJQHGIRUWKHEHJLQQLQJSDLQWHUXVLQJYDULRXV OLJKWLQJLQYHUVHNLQHPDWLFVNLQHPDWLFVDQGPRWLRQ3K\VLFVZLOO WHFKQLTXHV0HGLD ZDWHUFRORUDQGRLO RUDFU\OLF 3UHUHTXLVLWH be addressed but not emphasized. Prerequisites: IT100, AR214. AR 221, 240, or permission of instructor. 2IIHUHGLQVSULQJRIHYHQDOWHUQDWH\HDUV AR 233, AR 333 Ceramics, Advanced Ceramics (3,3) AR 367 Printmaking (3) 3URMHFWVLQWKHYDULRXVFHUDPLFSURFHVVHVLQFOXGLQJKDQG The printing processes of basic Intaglio and Relief are explored. EXLOGLQJZKHHOWKURZLQJGHFRUDWLQJJOD]LQJDQG¿ULQJ Prerequisite: AR 111 or 221 or 240. May be repeated. Offered $GYDQFHG&HUDPLFVPD\EHUHSHDWHG HYHQDOWHUQDWH\HDUV AR 236 Photography AR 368 Metals The basics of 35 mm camera operation and black and white The processes of working ferrous and non-ferrous, precious, and darkroom practice with an introduction to digital imaging. semi-precious metals including fabricating, casting, and smithing. 2IIHUHGHYHQDOWHUQDWH\HDUV May be repeated. Prerequisite: AR 112. Offered odd alternate years. AR 237, 238 Art History I, II (3,3) 7KH¿UVWVHPHVWHULVDVXUYH\RIWKHKLVWRU\RISDLQWLQJ AR 373 History of American Art architecture and sculpture from a prehistoric to Renaissance $VXUYH\RISDLQWLQJVFXOSWXUHDUFKLWHFWXUHDQGWKHGHFRUDWLYH Western Art as well as units on Islamic and Asian. The second DUWVIURPHDUO\QDWLYH$PHULFDQFXOWXUHVWRWKHFRQWHPSRUDU\ VHPHVWHUFRYHUVIURPWKH5HQDLVVDQFHWRWKHSUHVHQW$5DQG 2IIHUHGHYHQDOWHUQDWH\HDUV AR 238 are offered in odd alternate years. AR 191, 291, 391, 491 Internship AR 240 Life Drawing (3) 6WXG\IURPWKHOLYLQJPRGHOZLWKVWUHVVRQVWUXFWXUHOLQHYDOXH AR 197, 297, 397, 497 Field Experience anatomy, proportions, and the dimensional effects of the human ¿JXUH0D\EHUHSHDWHG3UHUHTXLVLWH $5 AR 199, 299, 399, 499 Independent Research AR 315 Advanced Graphic Design (3) Computer-based problems with an emphasis on professional and Athletic Training FUHDWLYHVROXWLRQV3UHUHTXLVLWH $5 AT 100 – Introduction to Athletic Training This course is an introduction to the basic concepts of athletic AR 321 Advanced Drawing (3) training within the realm of sports medicine. The course will $GYDQFHG'UDZLQJLVDFRQWLQXDWLRQRIWKHFRQFHSWVDQG orient the student to the athletic training knowledge and skills theories in Drawing I with special focus on technique, media and QHHGHGIRUWKHSUHYHQWLRQHYDOXDWLRQDQGWUHDWPHQWRIDWKOHWLF FUHDWLYLW\DQGWKHGHYHORSPHQWRISHUVRQDOVW\OH LQMXULHV2IIHUHGLQWKHIDOOVHPHVWHU AR 322 Advanced Painting (3) AT 200 – Orthopedic Injury Pathology Course Descriptions 55 This course will instruct the student about the mechanisms, FRXUVHZLOOSURYLGHVWXGHQWVWKHRSSRUWXQLW\WROHDUQDERXW GHYHORSPHQWDQGSURJUHVVLRQRILQMXULHVVXVWDLQHGGXULQJDWKOHWLF commonly accepted techniques and procedures for clinical DFWLYLW\7DSLQJEDQGDJLQJDQGEUDFLQJVNLOODUHDOVRGHYHORSHG HYDOXDWLRQDQGUHFRJQLWLRQRIWKHVLJQVDQGV\PSWRPVRIDWKOHWLF Offered in the spring semester. Prerequisite: successful comple- LQMXULHV7KLVFRXUVHUHTXLUHVWZRKRXUVRIFODVVWLPHDQGWZR tion of AT 100 hours of laboratory time each week to instruct the students in the HYDOXDWLRQSURFHVV$7LVRIIHUHGLQWKHIDOOVHPHVWHUDQG$7 AT 210 – General Medical Conditions 401 is offered in the spring semester. Prerequisite: acceptance This course will instruct the student about the knowledge and into the ATEP. skills needed to recognize, treat, and refer, when appropriate, general medical conditions and disabilities of athletes and others AT 420-Therapeutic Exercise (3) LQYROYHGLQSK\VLFDODFWLYLW\2IIHUHGLQWKHIDOOVHPHVWHU3UH- (VVHQWLDOFRPSRQHQWVRIDFRPSUHKHQVLYHUHKDELOLWDWLRQSURJUDP requisite: acceptance into the ATEP. LQFOXGLQJJRDOVREMHFWLYHH[HUFLVHVHOHFWLRQPHWKRGVRI HYDOXDWLQJDQGUHFRUGLQJSURJUHVVDQGGHYHORSPHQWRIFULWHULDIRU AT 290, 292 – Practicum I and II progression and return to competition. This course requires two 7KHVHFRXUVHVDUHIRUWKHVRSKRPRUHOHYHO$7(3VWXGHQWVRQO\ hours of class time and two hours of laboratory time each week 7KHFRXUVHVZLOODOORZWKH$7(3VWXGHQWVWRGHYHORSFOLQLFDO to instruct students in the rehabilitation process. Offered in the VNLOOVZKLOHZRUNLQJXQGHUWKHVXSHUYLVLRQRIDFHUWL¿HGDWKOHWLF spring semester. Prerequisite: acceptance into the ATEP. WUDLQHUFOLQLFDOLQVWUXFWRU7KHVWXGHQWV¶SUR¿FLHQF\LQWKHFOLQLFDO VNLOOVZLOODOVREHHYDOXDWHG$7 LVRIIHUHGLQWKHIDOODQG AT 481 – Organization and Administration of Health, Physi- is offered in the spring. Prerequisite: acceptance into the ATEP. cal Education and Sport This course will instruct the student in the knowledge and skills AT 300-Therapeutic Modalities (3) needed to properly administrate the policies, facilities, and equip- Examination of the application and physiological responses to PHQWUHTXLUHGWRRIIHUDWKOHWLFWUDLQLQJVHUYLFHV7KH¿UVW¿YH selected therapeutic modalities including cold, heat, electrical, ZHHNVRIWKHFRXUVHZLOOGLVFXVVFRQFHSWVSHUWDLQLQJWRHYHU\RQH traction and massage to the athletic trainer. This course requires in the Sport Science department. The remaining ten weeks will two hours of class time and two hours of laboratory time to EHVSHQWZLWKDFHUWL¿HGDWKOHWLFWUDLQHUGLVFXVVLQJWKRVHFRQFHSWV SURYLGHWKHVWXGHQWZLWKWKHRSSRUWXQLW\WROHDUQDERXWPRGDOLWLHV SHUWDLQLQJVSHFL¿FDOO\WRDWKOHWLFWUDLQLQJ2IIHUHGLQWKHIDOO in athletic training. Offered in the fall semester. Prerequisite: semester. acceptance in ATEP. AT 490, 492 – Practicum V and VI AT 330 – Pharmacology 7KHVHFRXUVHVDUHIRUWKHVHQLRUOHYHO$7(3VWXGHQWVRQO\7KH This course will instruct the student in the knowledge of medi- FRXUVHVZLOODOORZWKH$7(3VWXGHQWVWRGHYHORSFOLQLFDOVNLOOV FDWLRQVXVHGWRWUHDWLQMXULHVDQGLOOQHVV7KHFRXUVHZLOODOVR ZKLOHZRUNLQJXQGHUWKHVXSHUYLVLRQRIDFHUWL¿HGDWKOHWLFWUDLQHU include the discussion of elicit drugs and how health care profes- FOLQLFDOLQVWUXFWRULQRIIFDPSXVVHWWLQJV7KHVWXGHQWV¶SUR¿- VLRQDOVFDQLQWHUYHQHRQEHKDOIRIWKRVHLQGLYLGXDOVXVLQJHOLFLW FLHQF\LQWKHFOLQLFDOVNLOOVZLOODOVREHHYDOXDWHG$WWKHFRPSOH- GUXJV2IIHUHGLQWKHVSULQJVHPHVWHULQHYHQDOWHUQDWH\HDUV WLRQRIWKLV¿HOGSODFHPHQWHDFKVWXGHQWZLOOEHH[SHFWHGWRJLYH DQRUDOSUHVHQWDWLRQ FDSVWRQHH[SHULHQFH WRWKH6SRUW6FLHQFH AT 340 – Nutrition )DFXOW\IRUWKH¿QDODVVHVVPHQW$7 LVRIIHUHGLQWKHIDOODQG This course will instruct the student in the concepts of proper nu- 492 is offered in the spring. Prerequisite: successful completion WULWLRQDQGKRZLWFDQEHQH¿WSK\VLFDOO\DFWLYHLQGLYLGXDOV7KHVH of Practicum I-IV. FRQFHSWVLQFOXGHWKHEDVLFQXWULWLRQDOFRPSRQHQWV SURWHLQV FDUERK\GUDWHVIDWVYLWDPLQVPLQHUDOVDQGZDWHU FDORULFLQWDNH weight management, pre-game meals, and eating disorders. Of- Business Administration fered in the spring semester in odd alternate years. BA 211 Quantitative Business Analysis Mathematical techniques applied to management decision- AT 390, 392 – Practicum III and IV PDNLQJ7LPHYDOXHRIPRQH\PDWUL[DOJHEUDIXQFWLRQVJUDSKV linear programming, business decision models. 7KHVHFRXUVHVDUHIRUWKHMXQLRUOHYHO$7(3VWXGHQWVRQO\7KH Prerequisite: one year of high school Algebra or GS 098. FRXUVHVZLOODOORZWKH$7(3VWXGHQWVWRGHYHORSFOLQLFDOVNLOOV ZKLOHZRUNLQJXQGHUWKHVXSHUYLVLRQRIDFHUWL¿HGDWKOHWLF BA 212 Business Statistics (3) WUDLQHUFOLQLFDOLQVWUXFWRU7KHVWXGHQWV¶SUR¿FLHQF\LQWKHFOLQLFDO Statistical measures and analysis, probability, sampling, VNLOOVZLOODOVREHHYDOXDWHG$7 LVRIIHUHGLQWKHIDOODQG is offered in the spring. Prerequisite: successful completion of hypothesis testing, regression, and correlation applied to business Practicum I and II. decision-making. AT 400, 401-Evaluation of Athletic Injuries I and II (3,3) BA 228 Business Communication 7KHVHFRXUVHVZLOOEHFRPSOHWHGLQFRQVHFXWLYHVHPHVWHUV7KH $VWXG\RIWKHSULQFLSOHVRIHIIHFWLYHZULWWHQFRPPXQLFDWLRQ Course Descriptions 56 DQGWKHLUDSSOLFDWLRQWREXVLQHVVVLWXDWLRQV$FRPSUHKHQVLYH VWXG\RIEXVLQHVVZULWLQJLQFOXGLQJOHWWHUVPHPRVLQWHURI¿FH correspondence and complete analytical report writings. Biology Prerequisite: EN 111. BI 110 Introduction to Biology $VWXG\RIOLIHDVDQHYROYLQJV\VWHPDQGWKHZD\ELRORJLVWV BA 250 Personal Finance LQYHVWLJDWHWKHYDULRXVDVSHFWVRIVXFKDPXOWLGLPHQVLRQDO dynamic system. Particular emphasis is placed on the nature and 3HUVRQDO¿QDQFLDOSODQQLQJDQGPDQDJHPHQW IDPLO\EXGJHWLQJ function of man as such a system. Credit does not apply to the LQFRPHWD[HVLQVXUDQFHVDYLQJERUURZLQJUHDOHVWDWHDQG LQYHVWPHQWV2IIHUHGRQGHPDQG 1DWXUDO6FLHQFHPDMRUV BI 120 Botany BA 260 Business Ethics This course examines corporate citizenship and social responsi- $QLQWURGXFWLRQWRWKHVWXG\RISODQWVDQGWKHPDMRUSODQWJURXSV bility in a business context. It is designed to broaden and deepen +RZSODQWVIXQFWLRQLQPDLQWDLQLQJDQHQYLURQPHQWWKDWVXVWDLQV a student’s understanding of ethical issues that businesses need KXPDQOLIHLVHPSKDVL]HG/DERUDWRULHVLQFOXGH¿HOGWULSV to consider as part of responsible decision-making. Analysis of DQDWRPLFDODQGPRUSKRORJLFDOVWXGLHVLGHQWL¿FDWLRQDQGWKH stakeholders integrates the external and internal factors such as HIIHFWRIJOREDOHQYLURQPHQWDOFULVLVXSRQSODQWV political factors, global forces, employee issues, etc. BI 125 Modern Genetics The fundamentals of classical genetics and the basic principles of BA 363 Business Law KXPDQJHQHWLFVDUHSUHVHQWHGIRUWKHQRQVFLHQFHPDMRU*HQHWLF Introduction to commercial law: torts, contracts, sales, negotiable engineering in bacteria, domestic plants and animals, and in instruments, agency, patents, copyrights, and bankruptcy. human medicine will be discussed with the ethical issues raised 3UHUHTXLVLWH MXQLRUVWDQGLQJ by this new technology. Credit does not apply to the Natural 6FLHQFHPDMRUV BA 397 Management Internship Students work at no pay for local employers in a management BI 129 Zoology WUDLQHHFDSDFLW\ GHVLJQHGPDLQO\IRUVWXGHQWVZLWKRXWSUHYLRXV $QLQWURGXFWLRQWRWKHVWUXFWXUDODQGIXQFWLRQDOGLYHUVLW\RIWKH IXOOWLPHH[SHULHQFH*UDGHG3)3UHUHTXLVLWH MXQLRUVWDQGLQJ animal kingdom and the biological phenomena common to all DQGPDMRULQ%XVLQHVV$GPLQLVWUDWLRQGHSDUWPHQW animals. BA 490 Business Policy BI 194 Biological Science (3) A senior capstone course which applies what has been learned 7KLVFRXUVHSURYLGHVDEDVLFXQGHUVWDQGLQJRIELRORJLFDO LQSUHYLRXVFRXUVHVWRUHDOLVWLFEXVLQHVVVLWXDWLRQV%XVLQHVV FRQFHSWV,WZLOOFRYHUFHOOIXQFWLRQSODQWVDQLPDOVJHQHWLFV strategies, policy-making, and management philosophy are JHQHWHFKQRORJ\HYROXWLRQDQGDGHVFULSWLRQRIWKHKXPDQERG\ GHYHORSHGE\PHDQVRIFDVHVWXGLHVRIDFWXDOFRPSDQLHV V\VWHPV&XUUHQWLVVXHVLQVFLHQFHZLOODOVREHFRYHUHG7KH Prerequisite: senior standing and completion of substantially all ODERUDWRU\FRPSRQHQWZLOOH[SORUHWKHVFLHQWL¿FPHWKRGDQG the Business Core. GHYHORSDQXQGHUVWDQGLQJRIKRZH[SHULPHQWDWLRQDQVZHUV questions in biology. BA 194, 294, 394, 494 Cooperative Education &RRSHUDWLYHHGXFDWLRQLVDVXSHUYLVHGZRUNH[SHULHQFHUHODWHG BI 235, 236 Human Anatomy and Physiology I,II WRDVWXGHQW¶VPDMRURU¿HOGRILQWHUHVW$VWXGHQWVKRXOGEH A systematic approach to the structure and function of the employed full-time with pay and should not be enrolled in KXPDQERG\7KLVWZRFRXUVHVHTXHQFHZLOOFRYHUWKHVWUXFWXUH other courses except by special permission of the coordinator of the human body and a systems approach to the functions, RIFRRSHUDWLYHHGXFDWLRQ$VWXGHQWPD\HDUQXSWRFUHGLWV homeostasic mechanisms, and the interrelationships of human XSRQFRPSOHWLRQRIWZRWKUHHPRQWKVXPPHUWHUPV IRXUFUHGLWV RUJDQV\VWHPV6SRUW6FLHQFHPDMRUVPD\FRXQWWKHVHFRXUVHV HDFK DQGRQHVL[PRQWKLQWHUQVKLS HLJKWFUHGLWV 2WKHUZRUN toward the general education science requirements. BI 235 must DUUDQJHPHQWVPXVWEHDSSURYHGE\WKHFRRUGLQDWRURIFRRSHUDWLYH EHWDNHQ¿UVW education and the Registrar. BI 250 Field Zoology BA 199, 299, 399, 499 Independent Research ,GHQWL¿FDWLRQDQGHFRORJLFDOUHODWLRQVKLSVRIWKHIDXQDRI ,QGHSHQGHQWUHVHDUFKPD\EHHLWKHUSURMHFWRUUHVHDUFKRULHQWHG 1RUWKZHVWHUQ2KLRDQGPHWKRGVRIGHVLJQLQJUHVHDUFKSURMHFWV 6XFKWRSLFVDUHQRWDQRUPDOSDUWRIWKHFXUULFXOXPDQGVHUYHWZR collecting and analyzing data, to monitor these populations. QHHGV ¿UVWWKHVWXGHQWLQYHVWLJDWHVDQDUHDRIVSHFLDOLQWHUHVW 2IIHUHGLQHYHQDOWHUQDWH\HDUV3UHUHTXLVLWH %, and second, the student works closely with a faculty member in SODQQLQJH[HFXWLQJDQGHYDOXDWLQJWKHSURJUDP BI 270 Field Botany 7KHVWXG\RISODQWFRPPXQLWLHVDQGHFRV\VWHPVLQWKH¿HOG Course Descriptions 57 7D[RQRP\FROOHFWLRQDQGSUHVHUYDWLRQIRUWKH&ROOHJH destroyed ecosystems will be studied. Emphasis will be placed herbarium, and additional laboratory exercises using keys are XSRQWKHUHVWRUDWLRQRIIRUHVWDQGSUDLULHHFRV\VWHPV([WHQVLYH included. Prerequisite: BI 120. Offered in odd alternate years. ¿HOGODERUDWRU\ZRUNZLOOLQFOXGHKDQGVRQH[SHULHQFHDWWKUHH PDMRUHFRORJLFDOUHVWRUDWLRQVLWHVZLWKLQHDV\GULYLQJGLVWDQFH BI 320 Ecology of the college campus. Prerequisite: BI 420 or permission of Principles of ecology including the organization, instructor. Offered odd alternate years. interrelationships, and dynamics of populations, communities, and ecosystems. Local terrestrial and aquatic communities will be BI 422 Restoration Ecology III (4) VWXGLHGLQWKH¿HOGDQGODERUDWRU\3UHUHTXLVLWHV %,%, The principle area of study is aquatic ecosystem restoration and BI 250, BI 270, or permission of the instructor. Offered in odd includes both freshwater and marine habitats. Efforts to restore alternate years. WKHZRUOG VRFHDQVODNHVULYHUVDQGVWUHDPVDUHGLVFXVVHG Hydrology, especially as it relates to ground water sources, BI 338 Histology is also emphasized. Laboratories focus on experimentation ([DPLQHVWKHPLFURVFRSLFDQDWRP\RIPDMRUFHOOW\SHVDQG WKDWSURPRWHVFULWLFDOWKLQNLQJDQGVROYLQJSUREOHPVUHODWHGWR tissues of the human body. Their form and function will be DTXDWLFKDELWDWUHVWRUDWLRQ2IIHUHGHYHQ\HDUVVSULQJVHPHVWHU H[DPLQHGDVREVHUYHGZLWKVOLGHVRIKXPDQDQGDQLPDOFHOOV Prerequisite: BI 420 or permission of instructor. and tissues. Relationships of cell types and tissues structures to physiological functions will also be studied. Prerequisite: BI BI 462 Immunology (4) %, 2IIHUHGLQHYHQDOWHUQDWH\HDUV Study of the human immune system. Includes innate and DGDSWLYHLPPXQLW\YDFFLQDWLRQDQGLPPXQLW\DXWRLPPXQH BI 350 Wildlife Management GLVHDVHK\SHUVHQVLWLYLW\DQGLPPXQRGH¿FLHQF\,PPXQRORJLFDO The art and science of encouragement and management of laboratory methods and cell culture techniques will be ZLOGOLIH+LVWRULFDODVSHFWVRIZLOGOLIHPDQDJHPHQWPDMRUIHGHUDO introduced. Prerequisites: BI 120, BI 129, and CH 124. Offered wildlife legislation, and application of ecological principles in in odd alternate years. ZLOGOLIHPDQDJHPHQWLQIHGHUDOVWDWHDQGSULYDWHODQGVDQG waters. Prerequisite: BI 320 or permission of instructor. Offered BI 480 Genetics (4) LQHYHQDOWHUQDWH\HDUV Mechanisms of inheritance in bacteria, plants, and animals. Emphasis on genetic inheritance in man. The current DNÅ BI 357 Comparative Vertebrate Anatomy technology and the ethical concerns surrounding these methods 7KHSK\ORJHQHWLFUHODWLRQVKLSVRIYHUWHEUDWHVOLYLQJDQG will be discussed. Laboratory will introduce genetic crosses, H[WLQFWDVUHYHDOHGE\WKHLUPRUSKRORJ\3UHUHTXLVLWH %, RU mitosis and meiosis and current DNA techniques. Prerequisites: permission of instructor. Offered in odd alternate years. %,%, DQG&+2IIHUHGLQHYHQDOWHUQDWH\HDUV BI 358 Microbiology (4) BI 481 Pathogenic Microbiology (4) Morphology, physiology, genetics and taxonomy of The etiology of human pathogens. Emphasis on bacterial and PLFURRUJDQLVPVDIIHFWLQJKXPDQVDQGWKHLUHQYLURQPHQW&XOWXUH YLUDOGLVHDVHVDQGKRVWSDUDVLWHUHODWLRQVKLSV/DERUDWRU\ methods and laboratory techniques for studying bacteria will be methods for identifying and isolating pathogenic organisms will introduced. Prerequisites: BI 120, BI 129, and CH 124. Offered be introduced. Prerequisite: BI 358 or permission of instructor. LQHYHQDOWHUQDWH\HDUV 2IIHUHGLQHYHQDOWHUQDWH\HDUV BI 420 Restoration Ecology I BI 490 Honors Anatomy and Physiology (1-3) An introduction to the new science of restoration ecology. $QDGYDQFHGKXPDQDQDWRP\DQGSK\VLRORJ\FRXUVHGHVLJQHG The most recent research regarding the rebuilding of complete IRUXSSHUOHYHOVWXGHQWVZKRKDYHGHPRQVWUDWHGWKHDELOLW\DQG HFRV\VWHPVZLOOEHUHYLHZHGDQGEDVLFHFRORJLFDOUHVWRUDWLRQ GHVLUHWROHDUQWKHVHVXEMHFWVLQORZHUOHYHOFODVVHV7KHFRXUVH principles studied. Laboratories will include using applied uses a number of excellent teaching modalities including human research techniques at the Thoreau Wildlife Sanctuary located FDGDYHUGLVVHFWLRQDQG%LRSDFSK\VLRORJ\(QUROOPHQWLVOLPLWHG QHDU'H¿DQFH&ROOHJH3UHUHTXLVLWH %,RUSHUPLVVLRQRI WRDPD[LPXPRIVL[VWXGHQWVDQGWKH¿QDOVHOHFWLRQLVEDVHG LQVWUXFWRU2IIHUHGLQHYHQDOWHUQDWHH\DUV XSRQLQYLWDWLRQE\WKHFRXUVHSURIHVVRUVZLWK¿QDODSSURYDOE\ WKH&KDLUSHUVRQRIWKH'LYLVLRQRI6FLHQFHDQG0DWKHPDWLFV BI 421 Restoration Ecology II Prerequisites: BI 235 and BI 236. Course may be repeated for up $GYDQFHGSULQFLSOHVDQGWHFKQLTXHVRIUHVWRULQJGDPDJHGRU to six credit hours. Communication Arts Course Descriptions 58 CA 111 Fundamentals of Oral Communication (3) This )XQGDPHQWDOWKHRULHVRIFRPPXQLFDWLRQDUHH[SODLQHGDQGJLYHQ course is an introduction to human communication. It includes SUDFWLFDOPRGHUQDSSOLFDWLRQ&RPSRQHQWVLQYHVWLJDWHGDUHYHUEDO the fundamentals of interpersonal, small group and public DQGQRQYHUEDOPHVVDJHVLQWHUSHUVRQDOUHODWLRQVKLSVJURXSDQG FRPPXQLFDWLRQ6WXGHQWVZLOOSDUWLFLSDWHLQDYDULHW\RI public communication, intercultural and gender communication. LQWHUSHUVRQDOVPDOOJURXSDQGSXEOLFVSHDNLQJDFWLYLWLHV7KH course focuses on the theory and practice of discourse with CA 216 Sophomore Portfolio Development (1) This course is immediate audiences. Theory includes thesis analysis, reasoning a co-requisite to CA215 Communication Theory. The goal of the VWUDWHJLHV DUUDQJLQJRUJDQL]DWLRQDOSDWWHUQV SUHSDUDWLRQDQG course is for students to create a portfolio of their current work to GHOLYHU\DXGLHQFHDQDO\VLVFULWLFDOOLVWHQLQJ DQGHWKLFVRI SURYHWKDWWKH\DUHDFKLHYLQJERWKWKHLURZQFDUHHUJRDOVDQGWKH SHUVXDVLYHGLVFRXUVH3UDFWLFHHPSKDVLVLVSODFHGRQGHYHORSLQJ stated learning outcomes of the Communication Arts department. YRFDOYDULHW\DUWLFXODWLRQDQGHQXQFLDWLRQ GLUHFWH\HFRQWDFW DQ Co-requisite:CA215 Communication Theory or CA235 Mass H[WHPSRUDQHRXVVW\OHRIGHOLYHU\ DQGSK\VLFDODSSHDUDQFH Media and Society. Prerequisite: CA111 Fundamentals of Oral Communication. CA 123 Media Communication (3) This course is a multimedia DSSURDFKWRMRXUQDOLVP,WLVGHVLJQHGWRGHYHORSWKHVWXGHQW¶V CA 221 Introduction to Acting (3) An introduction to the basic knowledge of corporate communication. The student will learn concepts of acting. Topics include characterization, focus, use of the relationship between non-print and print media and how to VSDFHFKDUDFWHUDQGWH[WDQDO\VLVDQGLPSURYLVDWLRQ select and prepare the appropriate medium, whether electronic or SULQWIRULQIRUPDWLRQGLVVHPLQDWLRQZLWKLQDJOREDOSHUVSHFWLYH CA 224 Public Opinion and Propaganda (3) This course 7KHFRXUVHDOVRHPSKDVL]HVVSHFL¿FVNLOOVLQQHZVZULWLQJ H[DPLQHVWKHYDULRXVSXUSRVHVRIODQJXDJHKRZSXEOLFRSLQLRQ news release preparations, brochure copy writing, and media is formed, and the communication and organizational strategies LQWHUYLHZV3UHUHTXLVLWH(1 XVHGWRLQÀXHQFHWKHIRUPDWLRQDQGFKDQJHRISXEOLFRSLQLRQ for different audiences and purposes. Propaganda is examined CA 130 Introduction to Film (3)7KLVFRXUVHSURYLGHVDQ KLVWRULFDOO\IURPERWKQHJDWLYHDQGSRVLWLYHSHUVSHFWLYHV2IIHUHG LQWURGXFWLRQWRWKHKLVWRU\DQGWHFKQLTXHVRI¿OP6WXGHQWVZLOO spring of odd alternate years. OHDUQWRDSSUHFLDWH¿OPDVDQDHVWKHWLFPHGLXPDQGGHYHORSWKH FULWLFDOIDFXOWLHVWRHYDOXDWHFRQWHPSRUDU\PRWLRQSLFWXUHV CA 231 Interpersonal Communication (3) 7KHFRXUVHLQYROYHV theoretical backgrounds as well as practical applications. It CA 135 Introduction to Media (3) An introduction to some key LVGHVLJQHGWRSURYLGHVWXGHQWVDQLPSURYHGDZDUHQHVVDQG themes in the study of popular media and to debates about the XQGHUVWDQGLQJRIWKHPVHOYHVDVFRPPXQLFDWRUV7KHFRXUVHZLOO role of media in contemporary societies. A range of media will be WHDFKVWXGHQWVKRZWRXVHWKLVXQGHUVWDQGLQJLQWKHLUHYHU\GD\ analyzed in detail. Theories of production, technology, audience OLYHVDQGKRZWRHQULFKERWKWKHLUSURIHVVLRQDODQGSHUVRQDO DQGUHSUHVHQWDWLRQZLOOEHH[SORUHGLQUHODWLRQWRDYDULHW\RI FRPPXQLFDWLRQH[SHULHQFHV2IIHUHGIDOORIHYHQDOWHUQDWH\HDUV PHGLDIRUPVDQGVRFLDOUHODWLRQV$SURMHFWZLOOHQFRXUDJHOLPLWHG LQYHVWLJDWLYHUHVHDUFK2IIHUHGVSULQJRIDOWHUQDWHHYHQ\HDUV CA 235 Mass Communication (3) This course is a study in Prerequisite: CA111 Fundamentals of Oral Communication the methods and philosophy of mass communication. Historical growth of the mass media is described. Interrelationships CA 210 Performing Arts (3) This course examines the role of of present forms of mass communication are linked to the YDULRXVSHUIRUPLQJDUWVDVWKH\UHODWHWRHDFKRWKHUWROLIHLQ underlying necessity to write, speak and think clearly and JHQHUDODQGWRWKHLQGLYLGXDO9DULRXVSHUIRUPLQJDUWVPD\EH KRQHVWO\7KLVFRXUVHLQFOXGHVWKHVFRSHDQGLQÀXHQFHRIYDULRXV VWXGLHGLQWKHFRXUVHDQGZLOOOLNHO\LQFOXGHVWXG\LQ¿OPPXVLF PDVVPHGLD UDGLRWHOHYLVLRQFDEOHFRPSXWHUQHZVSDSHUV DQGWKHDWHU'LVFXVVLRQVLQYROYHWKHUHODWLRQVKLSEHWZHHQVFRUH PDJD]LQHVDQGWKHDWHU SDUWLFXODUO\DVWKH\UHODWHWRVRFLHW\DQG and/or script and non-print representation and performances. WRWKHLQGLYLGXDOVZLWKLQLW2IIHUHGIDOORIRGGDOWHUQDWH\HDUV Prerequisite: HI 112. CA 242 Media, Race and Gender (3) This course explores the CA 212 Small Group Communication (3) The course combines ways in which race and gender are represented in newspapers, the theories of small group communication with the actual PDJD]LQHVWHOHYLVLRQ¿OPQHZVDQGDGYHUWLVLQJ7KHFRXUVH experience of working in small groups. Students will learn about DOVRH[DPLQHVWKHFXOWXUDOIRUFHVWKDWLQÀXHQFHKRZVXFK OHDGHUVKLSFRQÀLFWUHVROXWLRQSUREOHPVROYLQJWHFKQLTXHVLQ UHSUHVHQWDWLRQVDUHSURGXFHGDQGUHFHLYHGWKHLUSROLWLFDODQG DGGLWLRQWRDVVHUWLYHQHVVUKHWRULFDOVHQVLWLYLW\DQGYHUEDODQG EHKDYLRUDOFRQVHTXHQFHVDQGYDULRXVPHWKRGVIRUDQDO\]LQJ QRQYHUEDOHOHPHQWVRIPHVVDJHVDVWKH\DSSO\WRWKHVPDOOJURXS popular culture. The course also examines the history and SURFHVV2IIHUHGVSULQJRIHYHQDOWHUQDWH\HDUV status of people of color and women as media professionals. Prerequisite: CA 135 Introduction to Media. Offered spring of CA 215 Communication Theory (3) This course examines odd alternate years. the history of communication from Aristotle to the present. Course Descriptions 59 CA 300 Public Relations 7KHFRXUVHLQYROYHVWKHKLVWRU\RI performance of these materials. Each student will also prepare public relations, the function of the public relations practitioner, DQGGHOLYHUDVHULHVRIRUDOUHDGLQJVDQGSXEOLFDGGUHVVHV the basic skills of the science, and the differences between public GHVLJQHGWRHPSOR\WKHKXPDQYRFDOPHFKDQLVPLQDYDULHW\RI relations and marketing. Prerequisite: CA123. Offered fall of SHUIRUPDQFHVLWXDWLRQV2IIHUHGLQVSULQJRIHYHQDOWHUQDWH\HDUV HYHQDOWHUQDWH\HDUV CA 341 2D Digital Animation (3) This course introduces CA 311 Critical Public Address 7KLVFRXUVHFRQFHQWUDWHV the basic concepts of 2D digital animation. It focuses on RQWKHFRPPXQLFDWLRQVNLOOVRIGHOLYHU\DQGFULWLFDODQDO\VLV web purposed animation including animated GIF and Flash RISXEOLFVSHHFKHV6WXGHQWVZLOOGHYHORSDGYDQFHGVNLOOVLQ technology. Physics will be addressed but not emphasized. UHVRXUFHXVHWRSLFVHOHFWLRQDQGGHYHORSPHQWRUJDQL]DWLRQ Prerequisites: IT100, AR214. Offered in spring of odd alternate outlining, and critical analysis. The course is designed for years. students interested in communication careers or in careers requiring communication expertise. Prerequisite: CA111. It is CA 342 3D Digital Animation (3) This course introduces the offered spring of odd alternate years. basic concepts of 3D digital animation. It focuses on the basics of PRGHOLQJVNLQQLQJEXPSPDSSLQJOLJKWLQJLQYHUVHNLQHPDWLFV CA 315 Web Design And introduction to web design, kinematics and motion. Physics will be addressed but not the course presents practical application of commercial web emphasized. Prerequisites: IT100, AR214. Offered in spring of design software. It includes discussion of the aesthetic factors HYHQDOWHUQDWH\HDUV considered when creating multimedia using the web and the LQWHUQHW6WXGHQWVZLOOGHVLJQDQGGHYHORSZHESDJHVDQGSODFH CA 345 Media and Cultural Criticism (3) This course WKHPRQWKH&ROOHJHHGXFDWLRQDOVHUYHU3UHUHTXLVLWH $5RU ZLOOSURYLGHDQLQWURGXFWLRQWRFRQWHPSRUDU\DSSURDFKHVIRU permission of instructor. LQWHUSUHWLQJPHGLDWH[WV6WXGHQWVZLOOOHDUQWRDSSO\DYDULHW\RI FULWLFDOPHWKRGV LQFOXGLQJSV\FKRDQDO\WLFFULWLFLVPSRVWPRGHUQ CA 320 History and Programming of Electronic Media (3) FULWLFLVPDQGFXOWXUDOVWXGLHV WRSRSXODUFXOWXUH6WXGHQWVZLOO 7KLVFRXUVHWUDFHVWKHKLVWRULFGHYHORSPHQWRIWKHHOHFWURQLF OHDUQKRZWRHYDOXDWHWKHDHVWKHWLFTXDOLW\RISULQWDQGEURDGFDVW PHGLD UDGLRWHOHYLVLRQDQGFRPSXWHUFRPPXQLFDWLRQ 7KH messages. In addition, students will learn how to analyze the FRXUVHDOVRSURYLGHVVWXGHQWVZLWKDQXQGHUVWDQGLQJRIWKH PHDQLQJVYDULRXVDXGLHQFHVJURXSVFRQVWUXFWDURXQGPHGLDWH[WV PDMRUWUHQGVLQEURDGFDVWSURJUDPPLQJLQFOXGLQJHFRQRPLFDQG Offered spring of odd alternate years. JRYHUQPHQWDOSUHVVXUHV3UHUHTXLVWHV &$&RPPXQLFDWLRQ 7KHRU\DQG&$0DVV&RPPXQLFDWLRQ2IIHUHGVSULQJRIHYHQ CA 400 Multimedia Authoring I (3) This course introduces alternate years. WKHEDVLFFRQFHSWVRIDXWKRULQJ*8,V JUDSKLFDOXVHULQWHUIDFHV 7RSLFVLQFOXGHGH¿QLQJDQGDSSO\LQJPXOWLPHGLDXQGHUVWDQGLQJ CA 321 Advanced Acting (3) The focus of this course is on computer hardware/software components, using storyboarding performance skills for the actor including in-depth character and in the design process, and an introduction to non-linear scene study and certain staging techniques. May be repeated for QDYLJDWLRQDOFDSDELOLWLHVDQGLQWHUDFWLYLW\7RSLFVLQFOXGHOHDUQLQJ credit. Prerequisite: CA221 Introduction to Acting. DERXWZRUNLQJZLWKREMHFWVGH¿QLQJSURSHUWLHVGHVLJQLQJ LQWXLWLYHQDYLJDWLRQV\VWHPVDQGDGGLQJK\SHUWH[WIHDWXUHVWRDQ CA 324 Persuasion (3) 7KLVFRXUVHLQYROYHVDVWXG\RIWKHRULHV DSSOLFDWLRQ6WXGHQWVZLOOFUHDWHDQGSURGXFHDVLPSOHLQWHUDFWLYH RISHUVXDVLRQDQGDQDQDO\VLVRIWKHSURFHVVRISHUVXDVLYH application demonstrating newly acquired skills, including basic communication. It examines the role of persuasion within programming functions. Prerequisites: AR215 Intermediate multiple contexts and as a social force. Students will write at least *UDSKLF'HVLJQDQGMXQLRUVWDQGLQJ2IIHUHGIDOORIHYHQDOWHUQDWH RQHSHUVXDVLYHSDSHUDQGGHOLYHUDQRUDOSUHVHQWDWLRQEDVHGRQ years. WKDWSDSHU2IIHUHGVSULQJRIHYHQDOWHUQDWH\HDUV CA 421 Theatre Directing and Design (3) A practical course CA 330 Audio and Video Production (3) Fundamentals of ZKLFKLQYROYHVDOODVSHFWVRISOD\SURGXFWLRQ GLUHFWLQJVHW DXGLR YLGHRHTXLSPHQWRSHUDWLRQDQGSURGXFWLRQSULQFLSOHV design and construction, lighting, sound, costumes, stage ,QFOXGHVWKHEDVLFVRIZULWLQJSURGXFLQJDQGGLUHFWLQJYLGHR PDQDJHPHQWSURSVPDNHXSSXEOLFLW\ER[RI¿FHDQGKRXVH pre-production, production, and editing techniques. Prerequisite: PDQDJHPHQW3UHUHTXLVLWH &$$GYDQFHG$FWLQJ ,7RUSUR¿FLHQF\2IIHUHGIDOORIRGGDOWHUQDWH\HDUV CA 424 Public Advocacy (3) 7KHFRXUVHLQYROYHVWKHVWXG\RI CA 333 Communication and Performance (3) This informal logic as it applies in multiple contexts. Each student FRXUVHFRQVLVWVRIWKHVWXG\RIWKHKXPDQYRFDOPHFKDQLVP ZLOOOHDUQWRGHYHORSDQGSUHVHQWORJLFDODSSHDOVLQVXSSRUW problems associated with its use, and appropriate strategies for of social issues. The student will formulate claims, apply HQKDQFHPHQW7KHVWXGHQWZLOOFKDOOHQJHYRFDODELOLW\WKURXJK UHDVRQLQJWHFKQLTXHVJDWKHUDQGHYDOXDWHHYLGHQFHSUHSDUHFDVH selecting appropriate reading materials and executing the Course Descriptions 60 construction and cross-examinations for debate, and defend and 'LYLVLRQ&KDLUDQGWKH$FDGHPLF'HDQ refute ideas before a critical audience. The course will support the LQVWLWXWLRQVFRPPLWPHQWWRVHUYLFHOHDUQLQJE\KDYLQJWKHVWXGHQW CA 499 Seminar/Capstone 7KLVVHQLRUFDSVWRQH address issues of community concern in public forums. Offered H[SHULHQFHLQYROYHVLQGHSHQGHQWUHVHDUFKWKDWPD\EHHLWKHUD in fall of odd alternate years. SURMHFWRUUHVHDUFKRULHQWHG6HQLRUVZLOOZRUNFORVHO\ZLWKD communication arts faculty member in planning, executing, and CA 430 Mass Media and Society (3) This course examines HYDOXDWLQJWKHSURMHFW how communication media in the United States operate as industries, makers of meaning, and shapers of society. The FRXUVHLQYHVWLJDWHVWKHZD\WKDWPHGLDLQÀXHQFHSULYDWHOLYHV DQGWKHSXEOLFZRUOG GHPRFUDWLFLQVWLWXWLRQVHFRQRP\DQG FXOWXUH 7KHJRDORIWKLVFRXUVHLVWRKHOSVWXGHQWVEHFRPHPRUH critical consumers of the media and more informed citizens LQFRQWHPSRUDU\PHGLDVKDSHGVRFLHW\2IIHUHGIDOORIHYHQ Chemistry alternate years. CH 123, 124 General Chemistry I and II (4.4) A two-semester course dealing with atomic and molecular CA 440 Organizational Communication ,QWKLVFRXUVHWKH structure, the periodic table, Quantum understanding of atomic emphasis is on current theories of organizational communication, and molecular systems, kinetics, thermodynamics gas laws, the structure of organizations, how communication functions XQGHUVWDQGLQJDQGEDODQFLQJWKHPDMRUUHDFWLRQW\SHVWKHODZV ZLWKLQRUJDQL]DWLRQVDQGPDQDJHPHQWVW\OHV,WH[DPLQHVFRQÀLFW and rules that presently form our understanding of basic and resolution, networks, superior/subordinate communication, chemistry. At present the second semester lab is structured communication patterns inside and outside of the organization. DURXQGLQRUJDQLFTXDOLWDWLYHDQDO\VLV,QRUGHUWRPD[LPL]H 3UHUHTXLVLWH &$2IIHUHGVSULQJRIHYHQDOWHUQDWH\HDUV success in this two-semester course, high school chemistry, physics, and mathematics are strongly recommended. CA 454 Mediation (3)$YDULHW\RIUHDGLQJVH[HUFLVHVDQG role-plays will be employed to encourage rigorous analysis of CH 233, 234 Organic Chemistry I and II (4.4) mediation concepts and critical assessment of the application $WZRVHPHVWHUSURJUHVVLYHVWXG\RIRUJDQLFFDUERQFRPSRXQGV of these concepts in practice. The mediation class can be 7KLVFRXUVHLQFOXGHVQRPHQFODWXUHFRYDOHQWDQGLRQLFERQGLQJ incorporated into many different academic disciplines. Offered and reactions, reaction mechanisms, functional R groups, spring of odd alternate years. stereochemistry, interactions, alkane, alkene, aldyne, and aromatic reaction laws and rules. The laboratory is directed CA 191, 291, 391, 491 Internship 7KLVLVDQRQWKHMRE WRZDUGLVRODWLRQV\QWKHVLVDQGRUJDQLFUHDFWLYLW\/DERUDWRU\ learning experience related to the study of communication. An is concurrent and is graded and recorded separately. Second LQWHUQVKLSLVVXSHUYLVHGE\ERWKDFROOHJHIDFXOW\VSRQVRUDQGD VHPHVWHUODELQFOXGHVXQNQRZQTXDOLWDWLYHDQDO\VLV3UHUHTXLVLWH TXDOL¿HGSHUVRQLQWKH¿HOGZKHUHWKHVWXGHQWLVZRUNLQJDVDQ &KHPLVWU\DQGRUHTXLYDOHQWDVDSSURYHGE\GLYLVLRQ LQWHUQ1RVDODU\LVUHFHLYHGIRUDQLQWHUQVKLS*UDGHG3DVV)DLO chairperson and organic instructor. CA 194, 294, 394, 494 Cooperative Education $ CH233x,234x Organic Chemistry Laboratory FRRSHUDWLYHHGXFDWLRQFRXUVHLVDVXSHUYLVHGZRUNH[SHULHQFH UHODWHGWRDVWXGHQW¶VPDMRURU¿HOGRILQWHUHVW7KHVWXGHQWLV CH 368 Biochemistry I (4) HPSOR\HGZLWKSD\DQGZRUNDUUDQJHPHQWVPXVWEHDSSURYHGE\ An introduction to the biochemical principles including: WKH2I¿FHRI&DUHHUDQG6WXGHQW$VVLVWDQFHWKHDGYLVRUDQGWKH PDFURPROHFXOHV SURWHLQVOLSLGVFDUERK\GUDWHVDQGQXFOHLF Registrar. Graded Pass/Fail. DFLGV HQ]\PHVWUXFWXUHIXQFWLRQDQGUHJXODWLRQHQHUJ\ transformations, and carbohydrate, protein, and lipid CA 495 Special Topics $OWKRXJKIUHTXHQWO\SUHVHQWHGLQD metabolism. Prerequisites: CH 234, BI 120, and BI 129 or PDQQHUFRPSDUDEOHWRUHJXODUO\OLVWHGFRXUVHVWKHVXEMHFWPDWWHU permission of instructor. Offered in odd alternate years. of special topics is often of a more timely nature or for some other reason is not a regular part of the curriculum. Special topics CH 369 Biochemistry II: Molecular and Cellular Biology (4) are usually designed by a faculty member and are listed with the An introduction to the biochemistry of the cell including: nucleic other courses in the schedule. acids, nucleic acid metabolism, gene regulation, membranes, membrane transport, organelle biology, signal transaction and CA 498 Independent Study 7KHVHDUHSURMHFWVRUSDSHUV cancer biology. Emphasis on theoretical and practical use of ZKLFKKDYHEHHQGHVLJQHGE\VWXGHQWVZKRZLVKWRLQYHVWLJDWH molecular biological research techniques. Prerequisites: CH 368 DQDUHDRILQWHUHVWUHODWHGWRWKHLUPDMRUDUHDRIVWXG\7KHVH or permission of the instructor. Offered in odd alternate years. FRXUVHVPXVWEHDSSURYHGE\DIDFXOW\PHPEHUZKRZLOOVHUYH DVDQDGYLVRUIRUWKHSURMHFW WKH\PXVWDOVREHDSSURYHGE\WKH Course Descriptions 61 CH 455 Quantitative Analysis (4) +LVWRULFDOH[DPLQDWLRQDQGGHYHORSPHQWRIFRUUHFWLRQDO $QLQWHQVLYHVWXG\IRXUSODFHVWRWKHULJKWRIWKHGHFLPDO LQVWLWXWLRQVDQGMDLOV$QH[DPLQDWLRQRIYDULRXVW\SHVRIFXUUHQW LQFOXGLQJSUHFLVHODERUDWRU\PHWKRGV LQIUDUHGDQDO\VLV MDLOVDQGSHQDOLQVWLWXWLRQVDQGWKHLUIXQFWLRQV7KHFRXUVHZLOO FKURPDWRJUDSK\YROXPHWULFJUDYLQDPHWULFPHWKRGVDFLGEDVHG include a discussion of past and present issues of correctional theory, and equilibrium reactions. An emphasis is placed on data institutions, a brief look at international approaches and future FROOHFWLRQDQGVWDWLVWLFDODQDO\VLV7KHUXOHVDQGODZVJRYHUQLQJ WUHQGV3UHUHTXLVLWHV &-DQG622IIHUHGLQHYHQ this science are explored and explained. Prerequisites: CH 123 alternate years. DQGRUHTXLYDOHQWDVDSSURYHG CJ 354 Noninstitutional Corrections Criminal Justice Examination of all noninstitutional correction programs CJ 111 Introduction to Criminal Justice LQFOXGLQJSUHWULDOGLYHUVLRQSUREDWLRQSDUROHFRPPXQLW\EDVHG The philosophical, historical and operational aspects of criminal FRUUHFWLRQSURJUDPVLQQRYDWLYHDSSURDFKHVDQGFRUUHFWLRQDO counseling. A discussion of problems, concerns, and trends. MXVWLFHLQSUHVHQWVRFLHW\7KHDGPLQLVWUDWLRQDQGGH¿QLWLRQ Prerequisites: CJ 111, 223 and SO 120. Offered in odd alternate RIVFRSHRILQWHUHVWRIFULPLQDOMXVWLFHDJHQFLHVDQGKRZWKH\ interrelate. years. CJ 361 Delinquency Prevention and Control (3) CJ 127 Introduction to Juvenile Delinquency 7KHSKLORVRSKLFDOKLVWRULFDODQGRSHUDWLRQDODVSHFWVRIMXVWLFHLQ $FULWLFDOHYDOXDWLRQRIGHOLQTXHQF\FDXVDWLRQWKHRULHVDQGWKH social structures and their interrelationships with delinquency MXYHQLOHODZHQIRUFHPHQWDQGFRXUWV SUHYHQWLRQDQGFRQWURO3UHUHTXLVLWH &-DQG62 CJ 155 Criminal Law Study of elements and proof in crimes of frequent concern, CJ 373 Civil Liability procedural consideration of criminal law, and rules of law. Study of the general concepts of state tort law, negligence, search Prerequisite: CJ 111. DQGVHL]XUHYLRODWLRQVGHDGO\IRUFHDQGMDLOPDQDJHPHQW7KH VWXGHQWZLOODOVRH[DPLQHWKHEDVLVRIFLYLOOLDELOLW\JURXQGHG with federal law under 42 U.S.C. ~1983. The concept of liability CJ 217 Criminal Investigation ,QWURGXFWLRQWRFULPLQDOLQYHVWLJDWLRQSURFHGXUHVLQFOXGLQJ ZLOOWKHQEHVWXGLHGDVLWSHUWDLQVWRFULPLQDOMXVWLFHVXSHUYLVRUV WKHRU\RILQYHVWLJDWLRQFRQGXFWDWFULPHVFHQHFROOHFWLRQDQG LQFOXGLQJDGLVFXVVLRQRIGHIHQVHVDQGSROLF\GHFLVLRQVLQYROYLQJ SUHVHUYDWLRQRISK\VLFDOHYLGHQFHLQWURGXFWLRQWRUHODWHGIRUHQVLF FLYLOOLDELOLW\2IIHUHGLQHYHQDOWHUQDWH\HDUV VFLHQFHDQGIROORZXSOHJDOLQYHVWLJDWLRQ3UHUHTXLVLWH &- CJ 413 Criminal Justice Organization and Administration Principles of organization and management as applied primarily CJ 221 Criminal Evidence and Procedure to law enforcement and correctional agencies. Practical and 5XOHVRIHYLGHQFHRISDUWLFXODULPSRUWLQFULPLQDOMXVWLFH theoretical aspects of management, such as organization, decision WHVWLPRQ\SULYLOHJHVVHDUFKDQGVHL]XUHDQGH[FHSWLRQV Prerequisite: CJ 155. PDNLQJKXPDQUHODWLRQVDQGYDOXHV3UHUHTXLVLWHV &- CJ 451 The Juvenile Probate System (3) CJ 223 Introduction to Corrections $QLQWURGXFWLRQWRWKHYDULRXVDVSHFWVRIFRUUHFWLRQDOV\VWHPV ([DPLQHVWKHOHJDOSULQFLSOHVDQGSURFHGXUHVRIWKHMXYHQLOHDQG DQGWKHLUKLVWRULFDOGHYHORSPHQWDQGDQH[DPLQDWLRQRIVRFLHWDO SUREDWHFRXUWVDVLWUHODWHVWRWKHFULPLQDOMXVWLFHDQGHGXFDWLRQDO systems. The basic structure and operation of the American LQÀXHQFHVDQGUHDFWLRQVWRWUHDWPHQWRIRIIHQGHUVDQGYLFWLPV OHJDOV\VWHPLVFRQVLGHUHGDORQJZLWKOHJDOSURYLVLRQVUHODWHGWR CJ 351 Introduction to Criminalistics FULPHDQGGHOLQTXHQF\ FKLOGZHOIDUH HGXFDWLRQ IDPLO\ PHQWDO 6FLHQWL¿FDSSURDFKWRFULPLQDOLQYHVWLJDWLRQ FROOHFWLRQ KHDOWK JXDUGLDQVKLSVDQGWKHDOWHUQDWLYHVWRWKHVHSURFHGXUHV SUHVHUYDWLRQDQGWUDQVSRUWDWLRQRISK\VLFDOHYLGHQFH FULPH 2IIHUHGLQHYHQDOWHUQDWH\HDUV laboratory capabilities and limitations. Prerequisite: CJ 217. Offered in odd alternate years. CJ 471 Criminology An analysis of the sociocultural factors leading to crime with an emphasis on crime causation theories and methods used to CJ 352 Police-Community Relations 7KHSURIHVVLRQDOFRQFHSWLQSROLFLQJDQGLWVLPSOLFDWLRQV SUHYHQWDQGFRQWUROFULPLQDOEHKDYLRU3UHUHTXLVLWH &-DQG SO 120. Offered in odd alternate years. FKDQJLQJQDWXUHRIVRFLDOFRQWUROV FRPPXQLW\DQGSROLFH allocation of resources to deal with problems. Prerequisite: CJ CJ 472 Social Deviance 2IIHUHGLQHYHQDOWHUQDWH\HDUV $QDQDO\VLVRIWKHVRFLRFXOWXUDOIDFWRUVOHDGLQJWRGHYLDQW CJ 353 Institutional Corrections EHKDYLRUZLWKDQHPSKDVLVRQGHYLDQFHFDXVDWLRQWKHRULHVDQG SUHYHQWLRQFRQWURODQGWUHDWPHQWRIGHYLDQWEHKDYLRU Course Descriptions 62 CJ 473 Violent Crime EC 205 Macroeconomics $QDQDO\VLVRIWKHVRFLRFXOWXUDOIDFWRUVOHDGLQJWRYLROHQWFULPH Analysis of national economic policies: laissez-faire, Keynesian, HPSKDVL]LQJWKHFRUUHODWHVDQGFDXVHVRIYLROHQWFULPHDQGD DQGPRQHWDULVWWKHRULHVDSSOLHGWRWKHTXHVWLRQVRILQÀDWLRQ UHYLHZRIWKHVRXUFHVDQGSURFHGXUHVWRFODVVLI\DQGPHDVXUH XQHPSOR\PHQWJRYHUQPHQWVSHQGLQJDQGWD[DWLRQZRUOGWUDGH YLROHQWFULPH2IIHUHGLQRGGDOWHUQDWH\HDUV DQG¿QDQFHWKH)HGHUDO5HVHUYHDQGPRQHWDU\SROLF\1RWRSHQ to freshmen. CJ 478 Criminal Justice Seminar 6HQLRUFDSVWRQHH[SHULHQFH&RPSOHWLRQRIDPDMRUSDSHUDQGD EC 305 Money and Banking SUHVHQWDWLRQRIWKLVSDSHUWRDSURIHVVLRQDOSDQHORQDQDSSURYHG 5ROHDQGXVHVRIPRQH\WKHÀRZRIIXQGVFRQFHSWVRIWKHPRQH\ WRSLF'LVFXVVLRQDQGHYDOXDWLRQRISROLFLHVDQGSUDFWLFHVLQWKH VXSSO\WKH)HGHUDO5HVHUYHV\VWHPWRROVDQGHIIHFWVRIPRQHWDU\ ¿HOGZLWKDFFHSWHGWKHRULHVDQGSURFHGXUHV3UHUHTXLVLWHV &- policy, international monetary relations. Prerequisite: EC 201 and 217, 223 and 413. 205. Offered in odd alternate years. CJ 495 Special Topics EC 355 Public Finance Although frequently presented in a manner comparable to (FRQRPLFDVSHFWVRIJRYHUQPHQWVSHQGLQJWD[DWLRQDQG UHJXODUO\OLVWHGFRXUVHVWKHVXEMHFWPDWWHURIVSHFLDOWRSLFVLV LQGHEWHGQHVV DOORFDWLRQRIUHVRXUFHVEHWZHHQSXEOLFDQGSULYDWH often of a more timely nature, or for some other reason, is not JRRGV3UHUHTXLVLWH (&DQG2IIHUHGLQHYHQDOWHUQDWH a regular part of the curriculum. Special topics are usually years. designed by a faculty member and are listed with the other courses in the schedule. EC 375 International Trade (FRQRPLFDQGSROLWLFDODVSHFWVRIZRUOGWUDGH IUHHWUDGHYV CJ 194, 294, 394, 494 Cooperative Education protectionist policies, institutions affecting world trade, currency $FRRSHUDWLYHHGXFDWLRQFRXUVHLVDVXSHUYLVHGZRUNH[SHULHQFH H[FKDQJHUDWHVDQGZRUOGHFRQRPLFGHYHORSPHQW3UHUHTXLVLWH UHODWHGWRDVWXGHQW¶VPDMRURU¿HOGRILQWHUHVW$VWXGHQWVKRXOG MXQLRUVWDQGLQJ2IIHUHGLQRGGDOWHUQDWH\HDUV be employed full-time or part-time with pay. A student must complete 120 hours of work for each academic credit hour and may earn up to 16 credits. Other work arrangements must be Education ED 201 Phonics DSSURYHGE\WKHFRRUGLQDWRURIFRRSHUDWLYHHGXFDWLRQDQGWKH Registrar. $VWXG\RIWKHVRXQGV SKRQHPHV RIWKH(QJOLVKODQJXDJHDQG WKHGHYHORSPHQWDOVHTXHQFHRIWHDFKLQJWKHVHVRXQGVWRFKLOGUHQ Must be taken before or concurrently with ED 233 or ED 243. CJ 247 Field Experience (Lower-Level) $EDVLFH[SRVXUHWRDSDUWLFXODUFULPLQDOMXVWLFHDJHQF\WKURXJK ED 202 Instructional Technology REVHUYDWLRQDQGOLPLWHGSDUWLFLSDWLRQ7KLVFRXUVHZLOOSURYLGH - DQXQGHUVWDQGLQJRIKRZWKLVDJHQF\¿WVLQWRWKHHQWLUHFULPLQDO 7KLVFRXUVHLVGHVLJQHGWRSURYLGHH[SHULHQFHVWRWHDFKHUFDQ didates in the use of technology in teaching and learning. Data MXVWLFHV\VWHPDQGWKHORFDOFRPPXQLW\ 7KLVLVJUDGHGRQD collection, software selection, production and application of SDVVIDLOEDVLV technologies in lesson plans for use in classrooms will be studied. In this course, students will explore critical issues surrounding CJ 497 Field Experience (Upper-Level) the use of technology in educational settings. Students will also 7KLVOHYHOPHHWVWKHVDPHEDVLFREMHFWLYHVDVWKHORZHUOHYHODV ZHOODVZRUNLQJGLUHFWO\ZLWKRIIHQGHUVXQGHUVXSHUYLVLRQZKHQ FXOWLYDWHVNLOOVLQWKHXVHRIWHFKQRORJLFDODGYDQFHVUHOHYDQWWR current and future educational and professional experiences. This SRVVLEOH 7KLVLVJUDGHGRQDSDVVIDLOEDVLV course will be required of all license-seeking students Pre-K to CJ 199, 299, 399, 499 Independent Research Young Adult. ,QGHSHQGHQWUHVHDUFKPD\EHHLWKHUSURMHFWRUUHVHDUFKRULHQWHG ED 221 Foundations of American Public Education 6XFKWRSLFVDUHQRWDQRUPDOSDUWRIWKHFXUULFXOXPDQGVHUYHWZR The introductory course for all teacher licensure programs. The QHHGV ¿UVWWKHVWXGHQWLQYHVWLJDWHVDQDUHDRIVSHFLDOLQWHUHVW and second, the student works closely with a faculty member in format for the course is Problem Based Learning. Students work - SODQQLQJH[HFXWLQJDQGHYDOXDWLQJWKHSURJUDP LQFROODERUDWLYHJURXSVWRUHVHDUFKDQGSUHVHQW¿QGLQJVDERXWPD MRUSUREOHPVUHODWHGWRFRQWHPSRUDU\DQGFXUUHQWLVVXHVLQHGXFD- WLRQ6WXGHQWDVVHVVPHQWVLQFOXGHVHOIDQGIDFXOW\HYDOXDWLRQRI Economics WKHGLVSRVLWLRQV EHKDYLRU LGHQWL¿HGDVUHTXLUHGIRUEHFRPLQJDQ EC 201 Microeconomics HIIHFWLYHWHDFKHU6KRXOGEHWDNHQLQWKHVHFRQGVHPHVWHURIWKH $QLQYHVWLJDWLRQRIWKHSULQFLSOHVRISURGXFWLRQGLVWULEXWLRQ IUHVKPDQ\HDU. FRQVXPSWLRQDQGSULFHDVWKH\UHODWHWRWKHLQGLYLGXDOFRQVXPHU RU¿UP1RWRSHQWRIUHVKPHQ ED 228 Education of Exceptional Children Course Descriptions 63 A study of the characteristics of children with disabilities includ- VWXG\RIWKHLPSDFWRIWKHGLYHUVLW\RIODQJXDJHLQWKHKRPHLV LQJWKRVHZKRDUHDWULVNWKRVHZLWKGHYHORSPHQWDOYDULDWLRQV DGGUHVVHG5HDGLQJDFTXLVLWLRQDQGGHYHORSPHQWIURPOLQJXLVWLF DQGWKRVHZLWKVSHFLDOL]HGDELOLWLHV JLIWHG ZLOOEHDGGUHVVHG FRJQLWLYHSV\FKRORJLFDODQGFXUULFXODUSHUVSHFWLYHVDQGGHYHO- 7KHUHODWHGVHUYLFHVDQGDGDSWLYHWHFKQRORJLHVIRUFKLOGUHQZLWK RSPHQWDOO\DSSURSULDWHDFWLYLWLHVLQYROYLQJOLWHUDWXUHSDWWHUQV exceptionalities as well as the impact of family, cultural, racial, JDPHVDQGZULWLQJWRIRVWHUOLWHUDF\GHYHORSPHQWDUHH[SORUHG DQGHWKQLFGLYHUVLW\RQOHDUQLQJDUHH[SORUHG7KHFRXUVHDOVR Prerequisites: ('DQG3< DGGUHVVHVWKHODZDVLWUHODWHVWRVHUYLFHVIRUFKLOGUHQZLWKGLV- abilities and the role of the classroom teacher in the process. . ED 234 Early Childhood Practicum II 3UHUHTXLVLWHV ('3<DQGRU 6WXGHQWVZLOOVSHQGKDOIGD\VSHUZHHN WRWDOKRXUV LQDSUH NNLQGHUJDUWHQRUSULPDU\FODVVURRPVHUYLQJDVDQDSSUHQWLFH ED 229 Educational Psychology (3) to a master teacher. Students will also learn about: the school’s 7KHFRXUVHJLYHVWHDFKHUHGXFDWLRQPDMRUVWKHRSSRUWXQLW\WR SKLORVRSK\FXUULFXOXP VFRSHDQGVHTXHQFH KXPDQDQGSK\VL- OHDUQDERXWGHYHORSPHQWDOVWDJHVRIFKLOGUHQWKHVWXG\RIWKHR- cal resources and school classroom procedures. Students will be ries and principles of learning and ways these theories impact expected to rework a teacher’s or commercial lesson plans into a OHDUQLQJDQGWHDFKLQJ7KHRULHVRIPRWLYDWLRQLPSDFWRIOHDUQHU written format & teach the lesson as appropriate to the classroom GLYHUVLW\ HWKQLFVRFLRHFRQRPLFDQGFXOWXUDO OHDUQLQJVW\OH situation. Must be taken with ED 231 and/or ED 233. YDULDWLRQVPXOWLSOHLQWHOOLJHQFHVEUDLQKHPLVSKHULFLW\SK\VLFDOO\ Prerequisites: ('('('3<DQG3<. FKDOOHQJLQJFRQGLWLRQVDQGFRJQLWLYHVW\OHVDUHDOODGGUHVVHGDV ZD\VWKDWFODVVURRPSUDFWLFHLVLQÀXHQFHGDQGFKDQJHG ED 235 Expressive Arts 3UHUHTXLVLWHV ('3<DQGRU A study of the young child’s artistic, symbolic, and aesthetic GHYHORSPHQWLQDUWPXVLFDQGPRYHPHQW6WXGHQWVZLOOH[SHUL- ED 230 Principles of Early Childhood Education HQFHFULWLTXHDQGGHYHORSDSSURSULDWHH[SUHVVLYHDUWH[SHULHQF- The study of the nature, history, philosophy and organization of HV7HFKQLTXHVIRUDGDSWLQJPDWHULDOVDQGDFWLYLWLHVIRUVSHFLDO early childhood programs including the characteristics of effec- needs learners will also be explored. Students will earn 2 credit WLYHWHDFKHUVRI\RXQJFKLOGUHQDQGWKHHWKLFDOSULQFLSOHVWKH\ hours through scheduled class time and 1 credit hour through XSKROG,QWURGXFWLRQWRWKHFRQFHSWVRIGHYHORSPHQWDOO\DS- participation in “hands on” laboratory experiences. Prerequisites: propriate practices and teaching approaches that support learning ('$5RU&$DQG3< DQGWKHGHYHORSPHQWDOQHHGVRIFKLOGUHQDJHVWKUHHWKURXJKHLJKW Must be taken concurrently with ED 232. ED 236 Organization of Programs for Young Children 3UHUHTXLVLWHV ('3<DQG $VWXG\RIIDFWRUVLQYROYHGLQRUJDQL]LQJSURJUDPVIRUFKLOGUHQ ages three through eight including physical facilities, health and ED 231 Curriculum and Practices of Early Childhood VDIHW\SURFHGXUHVFODVVURRPDQGEHKDYLRUPDQDJHPHQWDQG $VWXG\RIWKHJXLGHOLQHVRIGHYHORSPHQWDOO\DSSURSULDWHFXU- requirements related to illness, communicable diseases, trauma, riculum to meet the needs of all learners including the culturally child abuse/neglect, record keeping, professional relationships, GLYHUVHDWULVNDQGH[FHSWLRQDOOHDUQHUV LQFOXGLQJJLIWHG DQG VWDIIGHYHORSPHQWDQGDJHQF\DQGIDPLO\SDUWLFLSDWLRQ6WXG\DQG consideration of the context of the children including multicultur- comparison of Ohio’s day care licensing standards, Pre-School DOSHUVSHFWLYHVVRFLRHFRQRPLFVWDWXVKRPHODQJXDJHDQGKRPH Special Needs Program Standards, Head Start Program Standards FXOWXUDOSUDFWLFHVDVSDUWRIFXUULFXOXPGHYHORSPHQW7KHFRXUVH and NAEYC Accreditation Standards and procedures are ad- LQFOXGHVSODQQLQJLPSOHPHQWDWLRQDQGHYDOXDWLRQRIOHDUQLQJ dressed. Prerequisites: DQG H[SHULHQFHVWRIDFLOLWDWHSOD\FRRSHUDWLYHOHDUQLQJHQYLURQPHQWV LQTXLU\DQGSUREOHPVROYLQJLQHDUO\FKLOGKRRGFODVVURRPV ED 237 Children’s Literature 0XVWEHWDNHQFRQFXUUHQWO\ZLWK(' Prerequisites: (' $VXUYH\RIOLWHUDWXUHDSSURSULDWHIRUFKLOGUHQDJHVWKUHHWKURXJK DQG3< JUDGHWKUHHZLWKHPSKDVLVRQLGHQWL¿FDWLRQRITXDOLW\OLWHUDWXUH ZLWKLQVHYHUDOJHQUHVDQGDYDULHW\RIZD\VWRLQFRUSRUDWHOLW- ED 232 Early Childhood Practicum erature into the curriculum within group and classroom settings. 6WXGHQWVREVHUYH RQHKDOIGD\SHUZHHN LQDYDULHW\RIHDUO\ ,QWHUDFWLYHWHFKQRORJ\ZLOOEHH[SORUHG6WXGHQWVZLOOKDYHRS- FKLOGKRRGFODVVURRPVWRXQGHUVWDQGWKHVFRSHDQGYDULHW\RISUR- SRUWXQLWLHVWRUHDGWRFKLOGUHQLQDYDULHW\RIFRQWH[WV JUDPPLQJWKDWLVDYDLODEOHIRU\RXQJFKLOGUHQDQGWRREVHUYHDQG discriminate aspects of appropriate practice in early childhood ED 243 Foundations and Survey of Reading and Phonics: programs. Prerequisites: ('DQG3<. Middle Childhood The Ohio Academic Standards in Reading and English are used ED 233 Phonics and Emergent Literacy to organize the instruction in the course. The course empha- $VWXG\RIWKHDVVRFLDWLRQRIVSHHFKVRXQGV SKRQHPHV ZLWK VL]HVUHDGLQJVWUDWHJLHVWKDWDUHYDOLGDWHGE\VFLHQWL¿FDOO\EDVHG SULQWHGV\PEROV JUDSKHPHV DVDPDMRUZRUGLGHQWL¿FDWLRQVWUDW- research in the teaching of reading and phonics. It presents egy with emphasis on the role of phonics in emergent literacy. A UHVHDUFKEDVHGSHUVSHFWLYHVDERXWUHDGHUVDQGSURJUDPVGHVLJQHG Course Descriptions 64 to meet reader needs. Knowledge of the reading process is ad- meaningful, “real-life” experiences. Must be taken with ED 334, dressed through understanding its relationship with phonemic, ED 336, ED 338 and ED 430. Prerequisites: Ed 201, 202, 221, morphemic, semantic, and syntactic systems of language. Atten- 228, 229, 230, 231, 232, 233, 234, 235, 237,330, 332, 335 and WLRQLVJLYHQWRZRUGUHFRJQLWLRQYRFDEXODU\DQGFRPSUHKHQVLRQ PY 225 and admission to the Teacher Education Program. VWUDWHJLHVXVHGWRGHYHORSÀXHQWUHDGHUV3UHUHTXLVLWHV (' ED 334 Social Studies Methods (2) The new Ohio Academic Standards in Social Studies and the 127( 3UHUHTXLVLWHVIRUDQGOHYHO0HWKRGVFODVVHV Pathwise Criteria will be used to learn about content curricular include ED 202, 221, 228, 229, PY 225 or PY 227, appropriate planning, teaching methodologies and implementation. Students OHYHOSUHUHTXLVLWHVDQGDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ ZLOOFULWLTXHDQGHYDOXDWHFXUULFXOXPPDWHULDOV,QVRFLDOVWXGLHV 3URJUDP6WXGHQWVZKRUHJLVWHUIRUDQGOHYHOFRXUVHV students will learn how to plan and implement curriculum that DQGGRQRWKDYHDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ3URJUDPZLOO relies on inquiry-based “minds on, hands on learning” and is be withdrawn from those courses. appropriate for young learners. Emphasis will be placed on LQWHJUDWLQJVRFLDOVWXGLHVFRQWHQWWRSURYLGHPHDQLQJIXO³UHDO ED 330 Reading and Math Field Experience (2) life” experiences. Must be taken with ED 333, ED 336, ED 338 Teacher education candidates will spend 2 half days per week and ED 430. Prerequisites: ED 201, 202, 221, 228, 229, 230, in a kindergarten or primary classroom for 10 weeks and 231, 232, 233, 234, 235,237, 330, 332, 335 and PY 225 and WKHQKDOIGD\VSHUZHHNIRUWKHODWHUZHHNVVHUYLQJDVDQ admission to the Teacher Education Program. apprentice to a master teacher. Candidates will plan, implement DQGHYDOXDWHWKHLUWHDFKLQJRIDVHW V RIOHVVRQVDQGRUXQLWV ED 335 Integrated Reading/Language Arts Methods: in Math and Reading as appropriate to the school’s curriculum Early Childhood content and/or school context. They will demonstrate ability to The Ohio Academic Standards in Reading and English are used VHTXHQFHLQVWUXFWLRQWKDWLVGHYHORSPHQWDOO\DSSURSULDWH GHYHORS to organize the instruction in the course. The course empha- DSSURSULDWHPHWKRGVIRUVWXGHQWVWRGHPRQVWUDWHOHDUQLQJ DQG VL]HVUHDGLQJVWUDWHJLHVWKDWDUHYDOLGDWHGE\VFLHQWL¿FDOO\EDVHG ZLOOEHYLGHRWDSHGGXULQJWKHVHPHVWHUDQGMRLQWO\FULWLTXHWKH UHVHDUFKLQWKHWHDFKLQJRIUHDGLQJ3URYLGHVWKHSUHVHUYLFH WDSHVZLWKFROOHJHVXSHUYLVRUV0XVWEHWDNHQFRQFXUUHQWO\ZLWK teacher with competency in the methods of teaching reading and ED 332 and 335. Prerequisites: ED 201, 202, 221, 228, 229, language arts to early learners. The course emphasizes compre- 230, 231, 232, 233, 234, 235, 237, and admission to the Teacher KHQVLYHFUHDWLYHDSSURDFKHVDQGVSHFL¿FWHFKQLTXHVLQYROYHGLQ Education Program. integrating listening, speaking, writing, grammar, reading, spell- ing and handwriting experiences for the young child. Focus on ED 332 Math Methods (2) LQWHJUDWHGGHYHORSPHQWRIFRPPXQLFDWLRQVNLOOV$RQHKDOIGD\ The new Ohio Academic Standards in Math and the Pathwise SHUZHHN FORFNKRXUVWRWDO SUDFWLFXPLVUHTXLUHGPrerequi- Criteria will be used to learn about content curricular planning, sites: (' teaching methodologies and implementation. Students will DQGDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ3URJUDP FULWLTXHDQGHYDOXDWHFXUULFXOXPPDWHULDOV6WXGHQWVOHDUQDERXW WKHGHYHORSPHQWRIQXPHULFDQGPDWKHPDWLFDOFRQFHSWVKRZ ED 336 Reading Diagnosis and Remediation with Early EHVWWRIDFLOLWDWHWKHLUGHYHORSPHQWZLWK\RXQJOHDUQHUVDQGWKH Childhood Practicum characteristics of what is called “reform” math. Emphasis will be The study of appropriate reading and reading readiness diagnostic placed on both skill-based learning and integrating math content and remedial procedures for assessing strengths and weaknesses WRRWKHUFXUULFXODUDUHDVWRSURYLGH³UHDOOLIH´H[SHULHQFHV0XVW in young learners are included. The use of the results of these be taken with ED 335 and ED 330. Prerequisites: Ed 201,202, procedures to create appropriate teaching strategies is addressed. 221, 228, 229, 230, 231, 232, 233, 234, 235, 237, and PY 225 and 6WXGHQWVZLOOKDYHWKHRSSRUWXQLW\WRGHYHORSDQGLPSOHPHQWGL- admission to the Teacher Education Program. agnostic and remedial strategies. Must be taken with ED 338 or an appropriate practicum placement. Prerequisites: (' ED 333 Science Methods (2) DQG3<DQG The new Ohio Academic Standards in Science and the Pathwise DQGDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ3URJUDP Criteria will be used to learn about content curricular planning, teaching methodologies and implementation related to science. ED 337 Best Practices In Early Childhood Curriculum 6WXGHQWVZLOOFULWLTXHDQGHYDOXDWHFXUULFXOXPPDWHULDOV The new Ohio Academic Standards in Social Studies, Math, Students will learn how to plan and implement curriculum that DQG6FLHQFH DQGWKH3DWKZLVH&ULWHULDZLOOEHXVHGWROHDUQ relies on inquiry-based “minds on, hands on learning” and is about content curricular planning, teaching methodologies and appropriate for young learners using concrete materials and LPSOHPHQWDWLRQ6WXGHQWVZLOOFULWLTXHDQGHYDOXDWHFXUULFXOXP experiences to built science concepts. Emphasis will be placed PDWHULDOV,QPDWKVWXGHQWVZLOOOHDUQDERXWWKHGHYHORSPHQWRI RQLQWHJUDWLQJVFLHQFHFRQWHQWZLWKRWKHUDUHDVWRSURYLGH numeric and mathematical concepts, how best to facilitate their Course Descriptions 65 GHYHORSPHQWZLWK\RXQJOHDUQHUVDQGWKHFKDUDFWHULVWLFVRIZKDW $QRYHUYLHZRITXDOLW\OLWHUDWXUHWKDWLVDSSURSULDWHIRUXVHZLWK is called “reform” math. In science and social studies, students preadolescent and adolescent readers. Focus on understanding will learn how to plan and implement curriculum that relies on DQGDSSOLFDWLRQRIHYDOXDWLYHFULWHULDVXFFHVVIXOWHFKQLTXHVIRU inquiry-based “minds on, hands on learning” and is appropriate incorporating literature across the curriculum, analysis of ele- for young learners. Emphasis will be placed on both skill-based PHQWVRIOLWHUDWXUHDQGZD\VRIHQFRXUDJLQJHQMR\PHQWDQGDS- learning in each of the curricular areas and integrating content to SUHFLDWLRQRIOLWHUDWXUH,QWHUDFWLYHWHFKQRORJ\ZLOOEHH[SORUHG SURYLGHPHDQLQJIXO³UHDOOLIH´H[SHULHQFHV0XVWEHWDNHQZLWK ED 338 and ED 430. Prerequisites: (G ED 342 Teaching Mathematics in Middle School DQG3<DQGDGPLVVLRQWR The Ohio Academic Standards in Math are used to organize the WKH7HDFKHU(GXFDWLRQ3URJUDP LQVWUXFWLRQLQWKHFRXUVH7KHFRXUVHHPSKDVL]HVGHYHORSPHQ- tally appropriate strategies, instructional techniques and materials ED 338 Integrated Practicum SURYHQHIIHFWLYHIRUPLGGOHFKLOGKRRGOHDUQHUV0DWKHPDWLFV Students will spend 3 half days per week in a pre-k, kindergarten FXUULFXOXPPDWKHPDWLFDOSUREOHPVROYLQJXVHRIPRGHOVDQG RUSULPDU\FODVVURRPVHUYLQJDVDQDSSUHQWLFHWRDPDVWHUWHDFKHU PDQLSXODWLYHVDSSOLFDWLRQVWRUHDOOLIHVLWXDWLRQVFDOFXODWRUV 7KH\ZLOOSODQLPSOHPHQWDQGHYDOXDWHWKHLUWHDFKLQJRIDVHW V and computer programs will all be used in this course. The need of lessons and/or units in Math, Social Studies and Science as and use of content embedded authentic assessment strategies as appropriate to the school’s curriculum content and/or school con- well as adaptation for learners with special needs are included. text. They will demonstrate ability to sequence instruction that Integration of mathematics with other curricular disciplines is LVGHYHORSPHQWDOO\DSSURSULDWHGHYHORSDSSURSULDWHPHWKRGVIRU also demonstrated. The course must be taken concurrently with students to demonstrate learning and use that information to alter ED 449. Prerequisites: (' IXWXUHLQVWUXFWLRQ6WXGHQWVZLOOEHYLGHRWDSHGDWOHDVWWZLFH DQG3<PRVWRIWKHPDWKHPDWLFV FRQWHQWDQGDGPLVVLRQWR GXULQJWKHVHPHVWHUDQGMRLQWO\FULWLTXHWKHWDSHVZLWKFROOHJH WKH7HDFKHU(GXFDWLRQ3URJUDP VXSHUYLVRUV0XVWEHWDNHQFRQFXUUHQWO\ZLWK('DQG Prerequisites: (' ED 343 Teaching Science in Middle School DQGDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ3URJUDP The Ohio Draft Academic Standards in Science are used to organize the instruction in the course. This course emphasizes ED 339 Middle Childhood Field Experience GHYHORSPHQWDOO\DSSURSULDWHVWUDWHJLHVLQVWUXFWLRQDOWHFKQLTXHV 6WXGHQWVZLOOVSHQGKDOIGD\SHUZHHN WRWDOKRXUV LQ DQGPDWHULDOVSURYHQHIIHFWLYHIRUPLGGOHFKLOGKRRGOHDUQHUV PLGGOHFKLOGKRRGFODVVURRP V JUDGHVWR LQWKHFRQWHQWDUHDV 6FLHQFHFXUULFXOXPVFLHQWL¿FLQTXLU\DQGSUREOHPVROYLQJXVH RIOLFHQVXUH VHUYLQJDVDSSUHQWLFHVWRPDVWHUWHDFKHUV6WXGHQWV RIPRGHOVDQGPDQLSXODWLYHVDSSOLFDWLRQVWRUHDOOLIHVLWXDWLRQV ZLOOOHDUQDERXW WKHVFKRRO¶VSKLORVRSK\FXUULFXOXP VFRSHDQG and computer programs will all be used in this course. The need VHTXHQFH KXPDQDQGSK\VLFDOUHVRXUFHVDQGVFKRROFODVVURRP and use of content embedded authentic assessment strategies as procedures. Students will be expected to rework a teacher’s or well as adaptation for learners with special needs are included. FRPPHUFLDOOHVVRQ V LQWRZULWWHQIRUPDWDQGWHDFKWKHOHVVRQ V Integration of science with other curricular disciplines is also as appropriate to the classroom situation. Must be taken concur- demonstrated. The course must be taken concurrently with rently with ED 340. Prerequisites:(' 3< ED 449. Prerequisites: (' DQG3<. DQG3<PRVWRIWKHVFLHQFHFRQWHQWDQGDGPLVVLRQWRWKH 7HDFKHU(GXFDWLRQ3URJUDP ED 340 Principles and Practices of Middle Level Education ED 344 Teaching Social Studies in Middle School An examination of the nature, philosophy, and organization of the The Ohio Draft Academic Standards in Social Studies are used PLGGOHVFKRRO WKHQDWXUHRIWKHPLGGOHVFKRROOHDUQHU FKDUDF- to organize the instruction in the course. The course emphasizes WHULVWLFVRIHIIHFWLYHPLGGOHVFKRRODGPLQLVWUDWRUVDQGWHDFKHUV GHYHORSPHQWDOO\DSSURSULDWHVWUDWHJLHVLQVWUXFWLRQDOWHFKQLTXHV EXLOGLQJVDQGVSHFL¿FURRPXWLOL]DWLRQLQWHUGLVFLSOLQDU\WHDP DQGPDWHULDOVSURYHQHIIHFWLYHIRUPLGGOHFKLOGKRRGOHDUQHUV organization, block scheduling, exploratory curriculum time, 6RFLDO6WXGLHVFXUULFXOXPKLVWRULFDOSUREOHPVROYLQJDQGLQTXLU\ WHDFKLQJPHWKRGRORJLHVDGYLVRUDGYLVHHSURJUDPVIDPLO\KRXVH use of models and simulations, and applications to real-life situa- LGHQWLW\'HYHORSPHQWRIDSSURSULDWHSURJUDPVLQDVXSSRUWLYH tions will all be used in this course. The need and use of content VFKRROHQYLURQPHQWDORQJZLWKWKHH[SORUDWLRQRIFODVVURRPDQG embedded authentic assessment strategies as well as adaptation EHKDYLRUPDQDJHPHQWVWUDWHJLHVZKLFKXQLTXHO\VHUYHPLGGOH for learners with special needs are included. Integration of social VFKRROVWXGHQWVDUHDOVRDGGUHVVHG6WXGHQWVZLOOKDYHWUDLQLQJLQ studies with other curricular disciplines is also demonstrated. The WKH3DWKZLVH&ULWHULDDQGSODQLPSOHPHQWDQGHYDOXDWHDSSUR- course must be taken concurrently with ED 449. Prerequisites: SULDWHDFWLYLWLHVIRUWKHFODVVURRPHQYLURQPHQW0XVWEHWDNHQ (' DQG3<PRVWRIWKH concurrently with ED 339. Prerequisites: (' PDWKHPDWLFV FRQWHQWDQGDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ 3<DQG3<. Program. ED 341 Middle Childhood and Adolescent Literature ED 345 Integrated Reading/Language Arts Methods: Middle Course Descriptions 66 School to demonstrate learning and use that information to alter future The Ohio Academic Standards in Reading/English are used to LQVWUXFWLRQ6WXGHQWVZLOOEHYLGHRWDSHGDWOHDVWWZLFHGXULQJWKH RUJDQL]HWKHLQVWUXFWLRQLQWKHFRXUVH7KHFRXUVHSURYLGHVPHWK- VHPHVWHUDQGMRLQWO\FULWLTXHWKHWDSHVZLWKFROOHJHVXSHUYLVRUV ods of teaching reading and language arts to middle school stu- Must be taken concurrently with ED 342, 343, 344, and/or 345. dents with emphasis on content reading. The course also includes Prerequisites: (' DQG3<PRVW methods of using curriculum embedded strategies to assess and RIWKHFRQWHQWFRXUVHVDQGDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ PRQLWRULQVWUXFWLRQEDVHGRQWKDWDVVHVVPHQW)RFXVRQYDULRXV Program. ways of integrating language instruction including literature, in- WHUGLVFLSOLQDU\XQLWVDQGRUJDQL]DWLRQDOYDULDWLRQVDUHSUHVHQWHG ED 352 Mathematics Methods: 7-12 Students are to take this course concurrently with 342, 343, 345 The Ohio Academic Standards in Math are used to organize DQGRU RURWKHUDUUDQJHGSUDFWLFXP Prerequisites: (' WKHLQVWUXFWLRQLQWKHFRXUVH7KHFRXUVHHPSKDVL]HVGHYHORS- DQG3<DQGDGPLVVLRQWRWKH mentally appropriate strategies, instructional techniques and 7HDFKHU(GXFDWLRQ3URJUDP PDWHULDOVSURYHQHIIHFWLYHIRUDGROHVFHQWOHDUQHUV0DWKHPDWLFV FXUULFXOXP LQFOXGLQJWUDGLWLRQDODQGUHIRUPPDWKSURJUDPV ED 346 Reading Diagnosis and Remediation: Middle Child- PDWKHPDWLFDOSUREOHPVROYLQJXVHRIPRGHOVDQGPDQLSXODWLYHV hood applications to real-life situations, calculators, and computer pro- The study of appropriate reading diagnostic and remedial pro- grams will all be used in this course. The need and use of content cedures for assessing strengths and weaknesses in middle-aged embedded authentic assessment strategies as well as adapta- learners are included. The use of the results of these procedures tion for learners with special needs are included. Integration of to create appropriate teaching strategies is addressed. Students mathematic content areas is also demonstrated. The course must ZLOOKDYHWKHRSSRUWXQLW\WRGHYHORSDQGLPSOHPHQWGLDJQRVWLF be taken concurrently with ED 497. Prerequisites: (' and remedial strategies. Must be taken with ED 348, 448 and DQG3<PRVWRIWKHPDWKHPDWLFV 498. Prerequisites: (' DQG FRQWHQWDQGDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ3URJUDP DQGRU , DQGDGPLVVLRQWRWKH7HDFKHU (GXFDWLRQ3URJUDP ED 353 Science Methods (7-12) The Ohio Draft Academic Standards in Science are used to ED 347 Reading in the Content Field organize the instruction in the course. This course emphasizes Using the Academic Content Standards in Reading/English as a GHYHORSPHQWDOO\DSSURSULDWHVWUDWHJLHVLQVWUXFWLRQDOWHFKQLTXHV focus, the course highlights the principles, techniques, strategies DQGPDWHULDOVSURYHQHIIHFWLYHIRUDGROHVFHQWOHDUQHUV6FL- DQGUHVRXUFHVZKLFKDLGWHDFKHUVLQGHYHORSLQJDQGVWUHQJWKHQ- HQFHFXUULFXOXPVFLHQWL¿FLQTXLU\DQGSUREOHPVROYLQJXVHRI ing student reading ability within school content areas. Focus on PRGHOVDQGPDQLSXODWLYHVDSSOLFDWLRQVWRUHDOOLIHVLWXDWLRQVDQG comprehension through attention to textbooks and their organiza- computer programs will all be used in this course. The need and tions, readability, student interests, schema theory and cultural use of content embedded authentic assessment strategies as well factors. Visual literacy is addressed. This course should be taken as adaptation for learners with special needs are included. The concurrently with ED 370 and 371. Prerequisites: (' course must be taken concurrently with ED 497. Prerequisites: DQGDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ3URJUDP (' DQG3<PRVWRIWKH science FRQWHQWDQGDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ3UR- ED 348 Reading Diagnostic and Remedial Field gram. Taken during the Internship. Students implement diagnostic procedures with middle childhood learners and plan content- ED 354 Social Studies Methods (7-12) based remedial strategies to aid in the reading process. Must be The Ohio Draft Academic Standards in Social Studies are used taken concurrently with ED 346, 448, and 498. Prerequisites: to organize the instruction in the course. The course emphasizes (' DQG DQGRU GHYHORSPHQWDOO\DSSURSULDWHVWUDWHJLHVLQVWUXFWLRQDOWHFKQLTXHV , DQGDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ3UR- DQGPDWHULDOVSURYHQHIIHFWLYHIRUDGROHVFHQWOHDUQHUV6RFLDO gram. 6WXGLHVFXUULFXOXPKLVWRULFDOSUREOHPVROYLQJDQGLQTXLU\XVH of models and simulations, and applications to real-life situations ED 349 Advanced Methods Practicum: Middle Childhood will all be used. The need and use of content embedded authentic Students will spend 2 half days per week in a middle school assessment strategies as well as adaptation for learners with spe- FODVVURRP V VHUYLQJDVDQDSSUHQWLFHWRDPDVWHUWHDFKHU7KH\ cial needs are included. Integration of social studies with other ZLOOSODQLPSOHPHQWDQGHYDOXDWHWKHLUWHDFKLQJRIDVHW V RI curricular disciplines is also demonstrated. The course must be OHVVRQVDQGRUXQLWVLQWKHFRQWHQWDUHDRIWKHLUOLFHQVH 0DWK taken concurrently with ED 497. Prerequisites:(' 6RFLDO6WXGLHV6FLHQFHRU5HDGLQJ/DQJXDJHDUWV DVDSSURSULDWH DQG3<PRVWRIWKHVRFLDOVWXGLHV to the school’s curriculum content and/or school context. They FRQWHQWDQGDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ3URJUDP ZLOOGHPRQVWUDWHDELOLW\WRVHTXHQFHLQVWUXFWLRQWKDWLVGHYHORS- PHQWDOO\DSSURSULDWHGHYHORSDSSURSULDWHPHWKRGVIRUVWXGHQWV ED 355 Integrated Reading/Language Arts Methods The Ohio Academic Standards in Reading/English are used as Course Descriptions 67 WKHEDVLVIRUWKHLQVWUXFWLRQLQWKHFRXUVH3UHVHUYLFHWHDFKHUV and interpreting assessment results to parents and professionals. GHYHORSFRPSHWHQF\LQWKHXVHRIDSSURSULDWHPHWKRGVIRUWHDFK- The need and use of curriculum embedded authentic assessment ing reading and language arts to adolescent students. Focus on strategies as well as adaptation for learners with special needs are YDULRXVZD\VRILQWHJUDWLQJODQJXDJHDUWVLQVWUXFWLRQLQFOXGLQJ included. 0XVWEHWDNHQFRQFXUUHQWO\ZLWK('DQG OLWHUDWXUHLQWHUGLVFLSOLQDU\XQLWVDQGRUJDQL]DWLRQDOYDULDWLRQVLV Prerequisites: (' also addressed. Must be taken concurrently with ED 497. DQGDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ3URJUDP Prerequisites: (' DQG 3<PRVWRIWKHLQWHJUDWHGODQJXDJHDUWVFRQWHQWDQGDGPLV- ED 432 Family and Community Relationships (2) VLRQWRWKH7HDFKHU(GXFDWLRQ3URJUDP Approaches for educators in collaborating with parents, agencies, . DQGRWKHUSURIHVVLRQDOVLQDGGUHVVLQJWKHLGHQWL¿HGQHHGVRIDOO ED 360 Arts Methods: Pre-K-12 children. Students will learn about the procedures used for IEP The Ohio Competency-Based Model for the Visual Arts is the ba- conferences and how to conduct parent conferences. Students VLVIRUWKHFRXUVH,QVWUXFWLRQDOPHWKRGRORJ\LQYLVXDODUWVZLOOEH will be expected to conduct at least one parent conference and/or SUHVHQWHGZLWKFORVHDWWHQWLRQWRLWVUHODWLRQVKLSWRWKHGHYHORS- KRPHYLVLW0XVWEHWDNHQFRQFXUUHQWO\ZLWK('DQG mental stages of the learners. Students will learn about materials, Prerequisites: (' methods, resources, and techniques in relation to teaching the DQGDGPLVVLRQWRWKH7HDFKHU YLVXDODUWV7KHQHHGDQGXVHRIFRQWHQWHPEHGGHGDXWKHQWLFDV- (GXFDWLRQ3URJUDP sessment strategies as well as adaptation for learners with special needs are included. The course must be taken with ED 497. Pre- ED 433 Early Childhood Internship requisites:(' RU DQG3< $QLQWHQVLYHZHHNIXOOGD\WHDFKLQJH[SHULHQFHLQDSUHN DQG DQG DGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ3URJUDP NLQGHUJDUWHQRUSULPDU\FODVVURRP PXVWEHDGLIIHUHQWDJHOHYHO WKDQLQ(' 6WXGHQWVZLOOZRUNLQSDUWQHUVKLSZLWKDPDVWHU ED 370 Teaching Secondary Students WHDFKHUWRSUDFWLFHWKHDUWDQGFUDIWRIWHDFKLQJDQGGHYHORSVNLOOV An examination of the nature, philosophy, and organization of the of planning and facilitating learning that are transferable to mul- VHFRQGDU\VFKRRO WKHQDWXUHRIWKHDGROHVFHQWOHDUQHU DSSURSUL- tiple early childhood contexts. Students will be assessed using DWHWHDFKLQJPHWKRGRORJLHV FKDUDFWHULVWLFVRIHIIHFWLYHDGPLQ- WKH3DWKZLVH&ULWHULDDQGGHYHORSWKHLURZQDVVHVVPHQWSRUWIROLRV LVWUDWRUVDQGWHDFKHUV EXLOGLQJVDQGVSHFL¿FURRPXWLOL]DWLRQ using the Pathwise Criteria. The student must meet the require- interdisciplinary team organization, block scheduling, exploratory ments for the Internship as described in the Teacher Education FXUULFXOXPWLPHDGYLVRUDGYLVHHSURJUDPVDQGLQWHJUDWHGFXU- Handbook including passage of the appropriate Praxis II content ULFXOXP+RZWRGHYHORSDSSURSULDWHSURJUDPVLQDVXSSRUWLYH WHVW V 0XVWEHWDNHQFRQFXUUHQWO\ZLWK('DQGPrereq- VFKRROHQYLURQPHQWDORQJZLWKWKHH[SORUDWLRQRIFODVVURRPDQG uisites: ED 202, 221, 228, 229, 230, 231, 232, 233, 234, 235, 237, EHKDYLRUPDQDJHPHQWVWUDWHJLHVIRUKLJKVFKRROVWXGHQWVDUHDOVR 335, 336, 337, 338, 430 and admission to the Teacher Education DGGUHVVHG6WXGHQWVZLOOKDYHWUDLQLQJLQWKH3DWKZLVH&ULWHULD Program. DQGSODQLPSOHPHQWDQGHYDOXDWHDSSURSULDWHDFWLYLWLHVIRUWKH FODVVURRPHQYLURQPHQW0XVWEHWDNHQFRQFXUUHQWO\ZLWK(' ED 448 Middle Childhood Internship 371 and 347. Prerequisites:(' 3<3< $QLQWHQVLYHZHHNIXOOGD\WHDFKLQJH[SHULHQFHLQDPLGGOH . VFKRROFODVVURRP V PXVWEHLQERWKFRQWHQWDUHDVRIWKHOLFHQVH 6WXGHQWVZLOOZRUNLQSDUWQHUVKLSZLWKDPDVWHUWHDFKHU V WR ED 371 Secondary Practicum SUDFWLFHWKHDUWDQGFUDIWRIWHDFKLQJDQGGHYHORSVNLOOVRISODQ- 6WXGHQWVZLOOVSHQGKDOIGD\SHUZHHN WRWDOKRXUV LQD ning and facilitating learning that are transferable to multiple KLJKVFKRROFODVVURRPV JUDGHVWRLQWKHFRQWHQWDUHDVRI contexts. Students will be assessed using the Pathwise Criteria WKHLUOLFHQVXUHDUHDV VHUYLQJDVDSSUHQWLFHVWRPDVWHUWHDFKHUV DQGGHYHORSWKHLURZQDVVHVVPHQWSRUWIROLRVXVLQJWKH3DWKZLVH Students will learn about: the school’s philosophy, curriculum Criteria. The student must meet the requirements for the Intern- VFRSHDQGVHTXHQFH KXPDQDQGSK\VLFDOUHVRXUFHVDQGVFKRRO ship as described in the Teacher Education Handbook including classroom procedures. Students will be expected to rework a SDVVDJHRIWKHDSSURSULDWH3UD[LV,,FRQWHQWWHVW V 0XVWEH teacher’s or commercial lesson into a written format & teach the taken concurrently with ED 346, 348, and 498. 3UHUHTXLVLWHV lesson as appropriate to the classroom situation. Must be taken (' DQGRU concurrently with ED 370 and ED 347. Prerequisites: (' DQG3< DQGDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ 3<DQG3<. Program. ED 430 Assessment of Young and Atypical Children ED 458 Internship in Adolescent/Young Adult &RQFHSWVDQGSULQFLSOHVRIPHDVXUHPHQWDQGDFWLYHSDUWLFLSDWLRQ $QLQWHQVLYHZHHNIXOOGD\WHDFKLQJH[SHULHQFHLQDKLJK in assessing young and atypical children ages three through eight VFKRROFODVVURRP V 6WXGHQWVZLOOZRUNLQSDUWQHUVKLSZLWKD IRUWKHSXUSRVHRIVWUDWHJLFSURJUDPSODQQLQJGHYHORSLQJLQGL- PDVWHUWHDFKHU V WRSUDFWLFHWKHDUWDQGFUDIWRIWHDFKLQJDQG YLGXDOL]HGHGXFDWLRQDOSODQV ,(3V,)63V WUDQVLWLRQSODQQLQJ GHYHORSVNLOOVRISODQQLQJDQGIDFLOLWDWLQJOHDUQLQJWKDWDUH Course Descriptions 68 transferable to other contexts. Students will be assessed using the analytical texts. The method includes writing as a process 3DWKZLVH&ULWHULDDQGGHYHORSWKHLURZQDVVHVVPHQWSRUWIROLRV LQYROYLQJGUDIWLQJUHYLVLRQDQGHGLWLQJ7KHFRXUVHLQFOXGHV using the Pathwise criteria. The student must meet the require- analyzing peer and professional writers’ works. Offered each ments for the Internship as described in the Teacher Education semester. EN 111 is the prerequisite for all remaining EN Handbook including passage of the appropriate Praxis II content courses. WHVW V 0XVWEHWDNHQFRQFXUUHQWO\ZLWK(' 3UHUHTXLVLWHV (' DQG RU EN 270 Advanced Composition 3<DQGDGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ3URJUDP 6WXGHQWVSUDFWLFHYDULRXVZULWLQJSURFHVVHVWKDWPHHWWKH requirements of different purposes and different audiences, ED 468 Internship in Pre-K-12 LQFOXGLQJZULWLQJGLUHFWLRQVIRUSURMHFWVDQ³,6HDUFK´SDSHUDQG $QLQWHQVLYHZHHNIXOOGD\WHDFKLQJH[SHULHQFHLQWKH WKHIRUPDOUHVHDUFKSURMHFW)RUPDOGUDIWVDQGHGLWHGSDSHUVPXVW FRQWHQWDUHD V RIWKHOLFHQVH 6WXGHQWVZLOOZRUNLQSDUWQHUVKLS be computer-generated. Prerequisite: EN 111. Offered in fall of ZLWKDPDVWHUWHDFKHU V WRSUDFWLFHWKHDUWDQGFUDIWRIWHDFKLQJ odd alternate years. DQGGHYHORSVNLOOVRISODQQLQJDQGIDFLOLWDWLQJOHDUQLQJWKDWDUH transferable to multiple contexts. Assignments, depending upon EN 275 Creative Writing WKHVFKRROGLVWULFWPD\EHGLYLGHGEHWZHHQDJHOHYHOV6WXGHQWV 7KHFRXUVHLVGHVLJQHGWRGHYHORSERWKWKHLPDJLQDWLYHDQG ZLOOEHDVVHVVHGXVLQJWKH3DWKZLVH&ULWHULDDQGGHYHORSWKHLU WHFKQLFDOUHVRXUFHVRIWKRVHVWXGHQWVLQWHUHVWHGLQFUHDWLYH own assessment portfolios using the Pathwise Criteria. The stu- writing. The course includes writing poetry, short stories, drama, dent must meet the requirements for the Internship as described DQGGHFRQVWUXFWLYHSRVWPRGHUQHVVD\VDVZHOODVFULWLTXLQJSHHU in the Teacher Education Handbook including passage of the and professional writers’ works. Prerequisite: EN 111. Offered in DSSURSULDWH3UD[LV,,FRQWHQWWHVW V 0XVWEHWDNHQFRQFXUUHQWO\ IDOORIHYHQDOWHUQDWH\HDUV with ED 498. Prerequisites: (' RU DQG 3<DQG DQG DGPLVVLRQWRWKH EN 280 Linguistics 7HDFKHU(GXFDWLRQ3URJUDP /LQJXLVWLFVLQWURGXFHVWKHRULHVWKDWH[SORUHWKHGHYHORSPHQW nature, and function of language. The areas studied include the ED 497 Advanced Methods Practicum; Grades 7 to 12 LQWHUQDOVWUXFWXUHRIODQJXDJH SKRQRORJ\PRUSKRORJ\V\QWD[ 6WXGHQWVZLOOVSHQGKRXUVLQDKLJKVFKRROFODVVURRP V VHUY- DQGVHPDQWLFV ODQJXDJHDQGWKHEUDLQODQJXDJHDFTXLVLWLRQDQG ing as an apprentice to a master teacher. They will plan, imple- GHYHORSPHQWIRUFHVRIODQJXDJHFKDQJH KLVWRULFDOGHYHORSPHQW PHQWDQGHYDOXDWHWKHLUWHDFKLQJRIDVHW V RIOHVVRQVDQGRU DQGODQJXDJHYDULDWLRQ GLDOHFWVDQGXVDJH 2IIHUHGLQVSULQJRI units in the content area of their licensure area as appropriate HYHQDOWHUQDWH\HDUV to the school’s curriculum content and/or school context. They ZLOOGHPRQVWUDWHDELOLW\WRVHTXHQFHLQVWUXFWLRQWKDWLVGHYHORS- EN 300 Stories and Images of Experience PHQWDOO\DSSURSULDWHGHYHORSDSSURSULDWHPHWKRGVIRUVWXGHQWV 6KRUWVWRULHVSRHPVSOD\VDQGRUQRYHOVSUHVHQWHGDVVWUXFWXUHG to demonstrate learning and use that information to alter future WH[WVWKDWVSHDNWRWKHYDULRXVWKHPHVDQGLVVXHVRIKXPDQ LQVWUXFWLRQ6WXGHQWVZLOOEHYLGHRWDSHGDWOHDVWWZLFHGXULQJWKH experience. The course emphasizes genre study and the close VHPHVWHUDQGMRLQWO\FULWLTXHWKHWDSHVZLWKFROOHJHVXSHUYLVRUV reading of texts. Prerequisites: EN111, AH 111 & 112. Offered Must be taken concurrently with 352, 353, 354, or 355. each semester. Prerequisites: (' LQWHJUDWHG/DQJXDJH $UWVRQO\ DQG3<PRVWRIWKHFRQWHQWDQG EN 310 Stories and Images of the Non-Western World DGPLVVLRQWRWKH7HDFKHU(GXFDWLRQ3URJUDP 6KRUWVWRULHVSRHPVSOD\VDQGRUQRYHOVSUHVHQWHGDVVWUXFWXUHG texts that speak to the themes and issues of non-western, ED 498 Internship Seminar indigenous cultures, such as those of Africa, the Far East, the $ZHHNO\VHPLQDUGHVLJQHGWRVXSSRUWWKHDFWLYLWLHVRIWKHLQWHUQV Near East, and North and South America. The course emphasizes during the internship. Interns meet each week with their col- the relationship between literature and culture, and the critical OHJHVXSHUYLVRUVDQGWKHQSDUWLFLSDWHLQZKROHJURXSDFWLYLWLHV approaches include reader-response and cultural criticism. including but not limited to teacher/principal panels, instruction Prerequisites: EN111, AH 111 & 112. EN 310 is the preferred LQMRXUQDOLQJXVLQJWKH3DWKZLVH&ULWHULDIRUVHOIDVVHVVPHQWDQG *'5RSWLRQFKRLFHIRUHGXFDWLRQPDMRUV2IIHUHGHDFKVHPHVWHU. making application for licensure. Must be taken with ED 433, 448, 458 or 468. Prerequisites:6HHSUHUHTXLVLWHVIRUWKHUHVSHF- EN 340 Survey of American Literature I WLYHLQWHUQVKLSV 7KHFRXUVHLQWURGXFHV$PHULFDQOLWHUDWXUHIURPWKHVHYHQWHHQWK to the mid-nineteenth century with attention to social and historical backgrounds and to the expanding canon of women English EN 111 Composition Students practice writing with an emphasis on academic Course Descriptions 69 and ethnic writers. The critical approaches include historical and Finance psychoanalytical criticism. Prerequisite: EN 111. Offered in fall FI 350 Business Finance of odd alternate years. 6XUYH\RI¿QDQFHIURPWKHSHUVSHFWLYHVRILQYHVWRUVEXVLQHVV ¿UPVDQG¿QDQFLDOLQVWLWXWLRQV7RSLFVLQFOXGH WKHEDQNLQJ EN 341 Survey of American Literature II system, capital markets, stocks and bonds, mutual funds, working $VWXG\RI$PHULFDQOLWHUDWXUHZLWKFRQFHQWUDWLRQRQPDMRU FDSLWDOPDQDJHPHQWVRXUFHVRI¿QDQFLQJ¿QDQFLDOGHFLVLRQ ODWHQLQHWHHQWKDQGWZHQWLHWKFHQWXU\ZULWHUVLQHDFKPDMRU making. Prerequisite: two semesters of accounting. genre, with attention to the expanding canon of women and ethnic writers. The critical approaches include feminist and FI 380 Risk Management multicultural criticism. Prerequisite: EN 111. Offered in spring Introduction to insurance and risk management for property, of odd alternate years. OLDELOLW\DQG¿QDQFLDOULVNV IULQJHEHQH¿WVVRFLDOLQVXUDQFH SURJUDPV ULVNDQDO\VLVDQGFRQWUROWHFKQLTXHV EN 350 Survey of British Literature I 7KHFRXUVHLQWURGXFHVUHSUHVHQWDWLYH$QJOR6D[RQ0HGLHYDO FI 452 Investment Analysis DQG5HQDLVVDQFHOLWHUDWXUH6SHFLDODWWHQWLRQLVJLYHQWRZRUNVRI )XQFWLRQLQJRIVWRFNH[FKDQJHVDQGRWKHUFDSLWDOPDUNHWV Chaucer, Shakespeare, and Milton as well as the expanding canon ¿QDQFLDODQDO\VLVIURPWKHLQYHVWRU¶VSRLQWRIYLHZ(PSKDVLVLV of women writers. The critical approaches include intellectual RQVHFXULW\DQDO\VLVYDOXDWLRQLQYHVWPHQWWLPLQJDQGSRUWIROLR history and the new historicism. Prerequisite: EN 111. Offered in theory. Prerequisite: EC 205, BA 212 ,and BA 350. Offered in IDOORIHYHQDOWHUQDWH\HDUV HYHQDOWHUQDWH\HDUV EN 351 Survey of British Literature II FI 455 Bank Management $VWXG\RIUHSUHVHQWDWLYHOLWHUDWXUHIURPWKH5RPDQWLFDJHWRWKH 7KHSULQFLSOHVRI¿QDQFLDOLQVWLWXWLRQPDQDJHPHQWZLWKHPSKDVLV SUHVHQWVXUYH\LQJWKHUHYROXWLRQDU\HUDWKHJURZLQJLQGXVWULDO RQOHQGLQJSUDFWLFHVRSHUDWLQJIXQGVDFTXLVLWLRQDQGLQYHVWPHQW society, and culminating in the complexities of the twentieth decisions. Examination of banking practices from a user’s century, particularly the expanding canon of women and ethnic SHUVSHFWLYHDVZHOODVDPDQDJHPHQWYLHZ3UHUHTXLVLWH VL[ writers. The critical approaches include biographical and cultural FUHGLWVLQDFFRXQWLQJ2IIHUHGLQHYHQDOWHUQDWH\HDUV FULWLFLVP3UHUHTXLVLWH (12IIHUHGLQVSULQJRIHYHQ alternate years. FI 459 Financial Management 5HDGLQJVDQGFDVHVWXGLHVUHODWHGWRFRUSRUDWH¿QDQFLDOGHFLVLRQV EN 395 Special Topics DQGSROLFLHV ¿QDQFLDODQDO\VLVZRUNLQJFDSLWDOPDQDJHPHQW Although presented in a manner comparable to regularly listed EXGJHWLQJDQGVRXUFHVRI¿QDQFLQJ)RFXVLVRQVSUHDGVKHHW FRXUVHVWKHVXEMHFWPDWWHULVQRWSDUWRIWKHUHJXODUFXUULFXOXP analysis and writing reports to top management. Prerequisite: BA Special topics courses are designed by a faculty member, and, 2IIHUHGLQVSULQJRIHYHQDOWHUQDWH\HDUV when they are offered, they are listed with the other courses in the class schedules. Freshman Seminar EN 496 Readings (1-3) FS 101 Freshman Seminar (3) Through a readings program, students may explore a special This course is designed as an introduction to college and helps OLWHUDU\RUOLQJXLVWLFWRSLFWR¿OODYRLGLQWKHLUEDFNJURXQG VWXGHQWVDGMXVWWRWKHDFDGHPLFDQGLQWHUSHUVRQDOFKDOOHQJHVRI 7KHUHDGLQJVSURJUDPLVGLUHFWHGWRZDUGVRPHVSHFL¿FJRDORU college life. Special attention is focused on learning more about SXUSRVH7KHVWXGHQWVXEPLWVDQDSSOLFDWLRQWRWKH'LYLVLRQ 'H¿DQFH&ROOHJH¶VHGXFDWLRQDODQGVHUYLFHRSSRUWXQLWLHVLQDG- &KDLUDQGWKH$FDGHPLF'HDQWKURXJKDIDFXOW\VXSHUYLVRU GLWLRQWRH[SORULQJWKHSUDFWLFDOYDOXHRIDOLEHUDODUWVHGXFDWLRQ 7KHFRXUVHLQFOXGHVDQRULHQWDWLRQWRWKH3LOJULP/LEUDU\YDULRXV EN 499 Independent Research (1-3) VSHDNHUVDQGDQLQWURGXFWRU\6HUYLFH/HDUQLQJH[SHULHQFH7KLV ,QGHSHQGHQWUHVHDUFKPD\EHHLWKHUSURMHFWRUUHVHDUFKRULHQWHG semester-long course is required of all full-time freshmen stu- 7KHVWXGHQWSODQVDQGFUHDWHVWKH¿QDOSURGXFWLQDQDUHDUHODWHG GHQWVEHORZWKHDJHRIZKRKDYHQRWKDGDVXFFHVVIXOFROOHJH WRKLVRUKHUPDMRUDUHDRIVWXG\7KHIDFXOW\PHPEHUZKRVHUYHV experience elsewhere. DVDQDGYLVRUIRUWKHSURMHFWPXVWDSSURYHWKHVWXGHQWJHQHUDWHG GHVLJQIRUWKHSURMHFWRUUHVHDUFK7KH'LYLVLRQ&KDLUDQGWKH $FDGHPLF'HDQPXVWDOVRDSSURYHG Course Descriptions 70 General Studies GE 232 World Geography (3) GS 086 Study Skills The geography of Europe, Asia, Africa and Austrailia with Approaches to the basic problems of studying with an emphasis emphasis on the natural resources, political conditions, economy, RQWKHFXOWLYDWLRQRIVRXQGDQGV\VWHPDWLFWHFKQLTXHVIRUWKH population and cultural patterns of each area. To a lesser extent LPSURYHPHQWRIWKHVWXGHQW¶VDFDGHPLFVXFFHVV&RYHUVWRSLFV the geography of the Americas will be studied. such as time management, note taking, textbook reading, and test-taking skills. Health Education HE 121 Foundations of Health, Physical Education and Sport GS 080 Spelling (1) (3) A diagnosis of spelling problems with exercises designed to bring The history and philosophy of health, physical education, and VSHOOLQJVNLOOVWRWKHUHTXLUHGOHYHOVIRUFROOHJHZRUNLQDOO¿HOGV sport are presented with career research and planning along of instruction. with the psychological and sociological implications of current physical education, health, and sport issues. Students are GS 085 Grammar (1) LQWURGXFHGWRSURIHVVLRQDOVLQWKHLUPDMRUDUHDRIVWXG\7KH\ $UHYLHZRIWKHEDVLFPRUSKRORJLFDO FKDQJHVWRZRUGV DQG will examine closely all professional organizations pertinent to SXQFWXDWLRQFRQYHQWLRQVRI6WDQGDUG:ULWWHQ(QJOLVK'LDOHFW their area of study. GS 088 Vocabulary (1) HE 125 Personal and Community Health (3) A concentration on increasing the student’s word power with an A study of current personal and community health issues which HPSKDVLVRQOHDUQLQJYRFDEXODU\WKURXJKNQRZOHGJHRIZRUG enables students to understand causes of, and solutions to present roots. day health problems. GS 090 Developmental Writing HE 130 Fitness for Life (2) 'HYHORSPHQWRIEDVLFVNLOOVLQZULWLQJ VWUDWHJLHVIRUDYRLGLQJ Designed to increase students knowledge and appreciation of LQDSSURSULDWHVODQJDQGGLDOHFWIRUGHYHORSLQJDSSURSULDWH VNLOOUHODWHGDQGKHDOWKUHODWHG¿WQHVVSULQFLSOHV6WXGHQWVZLOO VHQWHQFHVDQGSDUDJUDSKV(PSKDVLVRQGHYHORSLQJHIIHFWLYH GHYHORSDQGDSSO\WKHLUNQRZOHGJHRIKHDOWK\OLIHVW\OHVWKURXJK sentences and paragraphs. lecture and laboratory opportunities by writing about, and HQJDJLQJLQWKHLURZQ¿WQHVVSURJUDPVEDVHGRQSHUVRQDOQHHGV GS 095 Developmental Reading interests, and expectations. 'HYHORSPHQWRIEDVLFVNLOOVLQUHDGLQJ(PSKDVLVRQGHYHORSLQJ UHDGLQJFRPSUHKHQVLRQDQGH[SDQGLQJYRFDEXODU\ HE 177 School Health, Safety, and Services (3) $VWXG\RIKHDOWKVHUYLFHSURJUDPVLQFOXGLQJKHDOWKDSSUDLVDO GS 098 Developmental Mathematics KHDOWK\HQYLURQPHQWVDIHW\DQGFRPPXQLW\DJHQFLHVDQGKRZ An introduction to algebra including the real number system, they relate to health education in school and community settings. signed numbers, elemntary algebraic operations, linear equations +HDOWKKLVWRU\LVHPSKDVL]HGDORQJZLWKVWXGHQWLQWHUYLHZVDQG DQGIRUPXODVSUREOHPVROYLQJE\HTXDWLRQIDFWRULQJWKH REVHUYDWLRQVRIVFKRROSHUVRQQHO2KLRVFKRROODZLVGLVFXVVHG rectangular coordinate system, and graphs of linear equations. ZLWKLGHQWL¿FDWLRQRIPDQGDWHGDQGSHUPLVVLYHFXUULFXOXP content. GS 111 Portfolio Development Basics of portfolio design and content. Includes the study of HE 222 Pre K-3 Field Placement VNLOOVYDOXHVPHWKRGVDQGREMHFWLYHVRIDYDULHW\RIGLVFLSOLQHV This course is to be taken concurrently with HE 224. The LQUHODWLRQWRLQGLYLGXDOFRPSHWHQFLHVJDLQHGWKURXJKZRUN students will be placed in a partnership school, where they will be DQGRUOLIHH[SHULHQFH)RFXVRQWKHGHYHORSPHQWRIDQHIIHFWLYH ZRUNLQJZLWKFODVVURRPWHDFKHUVDWWKH3UH.OHYHO6WXGHQWV portfolio. Offered in spring semester. ZLOOEHH[SHFWHGWRGHYHORSDQGRUJDQL]HKHDOWKFRQFHSWVLQ HE 224 and then apply them through appropriate planning Geography DWWKHVSHFL¿FVFKRROFODVVURRPSODFHPHQW6WXGHQWVZLOOEH GE 132 Physical Geography YLGHRWDSHGDQGVSHFL¿FDVVHVVPHQWVZLOOEHFDUULHGRXWE\WKH /DQGIRUPVZHDWKHUDQGFOLPDWHVRLOVDQGYHJHWDWLRQDQGQDWXUDO classroom teacher and the college professor. KD]DUGV1DWXUHDQGGLVWULEXWLRQRIWKHVHHQYLURQPHQWDOHOHPHQWV DQGWKHLUVLJQL¿FDQFHWRPDQ2IIHUHGRQGHPDQG HE 224 Health and Physical Activity for Pre K-3 (3) 3UHVHQWDWLRQRIDFWLYLWLHVDQGPHWKRGRORJ\UHODWHGWRKHDOWK GE 231 Geography of the Americas and physical education Pre K-3. The methods and selected 7KHQDWXUDOUHVRXUFHVSK\VLFDOHQYLURQPHQWHFRQRP\ VWUDWHJLHVZLOOPHHWWKHJURZWKDQGGHYHORSPHQWQHHGVRIWKHVH population, and cultural patterns of North and South America. FKLOGUHQ,QIRUPDWLRQLQFOXGHG EDVLFKHDOWK VDIHW\ QXWULWLRQ FRPPXQLFDEOHGLVHDVHDQGDEXVH EDVLFUK\WKPLFZRUN FUHDWLYH Course Descriptions 71 Education, and Sport (3) SOD\GUDPD ERG\PDQDJHPHQW ORFRPRWRUDQGQRQORFRPRWRU Organization and administration of health, physical education, DQGPDQLSXODWLYHZRUN JDPHVRIORZRUJDQL]DWLRQ7KHUHLVD athletic training, and wellness programming will be addressed ¿HOGVHUYLFHFRPSRQHQWUHTXLUHGDVSDUWRIWKHFRXUVH with an emphasis on facility planning, equipment procurement, budgeting, program scheduling, community relationships, HE 256 Evaluation and Measurement in Health and Physical current issues, and legal & ethical concerns. After the initial core Education (3) ¿YHZHHNVRILQVWUXFWLRQWKHFRXUVHZLOOEHWHDPWDXJKWWRDOO 'HVLJQHGWRGHYHORSDSKLORVRSK\DQGVNLOOZLWKPHDVXUHPHQW VWXGHQWVWRVSHFLDOL]HZLWKLQWKHLUPDMRUDUHDRIVWXG\2SHQWR HYDOXDWLRQDQGWHVWLQJLQKHDOWKSK\VLFDOHGXFDWLRQDQGVSRUW MXQLRUVDQGVHQLRUVRQO\ 6WXGHQWVZLOOKDYHRSSRUWXQLWLHVWRFROOHFWDQGLQWHUSUHWGDWD XVLQJGHVFULSWLYHDQGLQIHUHQWLDOVWDWLVWLFDOPHWKRGV0RVW DVVLJQPHQWVZLOOEHWDLORUHGWR¿WVHWWLQJVZLWKLQWKHVWXGHQW V History area of study HI 221 United States History to 1900 (3) $VXUYH\RI86KLVWRU\IURP(XURSHDQFRQWDFWWR FRYHULQJ HE 334 Community First Aid and CPR (1) WKHPDMRUWKHPHVDQGLVVXHVLQWKLVFRXQWU\ VHDUO\KLVWRU\0DMRU 0HHWVWKHUHTXLUHPHQWVIRU5HG&URVVFHUWL¿FDWLRQLQFRPPXQLW\ WKHPHVLQFOXGHWKH&RORQLDODQG5HYROXWLRQDU\(UDV-DFNVRQLDQ ¿UVWDLGDQG&35LQFOXGLQJLQIDQWFKLOGDQGDGXOW&357KH $PHULFDWKH&LYLO:DUDQGWKH3RSXOLVW(UD FRXUVHFRQFHQWUDWHVRQWKHLPPHGLDWHWHPSRUDU\FDUHJLYHQWR WKHYLFWLP V RIDQDFFLGHQWRUVXGGHQLOOQHVVXQWLOSURIHVVLRQDO HI 222 European History from the Renaissance to 1900 (3) help is secured. After satisfactorily completing the practical $VXUYH\RI(XURSHDQKLVWRU\IURPWKH5HQDLVVDQFHWRWKH)UHQFK UHTXLUHPHQWVDQGWHVWVVWXGHQWVZLOOUHFHLYHFRPPXQLW\¿UVWDLG 5HYROXWLRQDQGLQGXVWULDODJHVIROORZHGXSE\DQLQGHSWK DQG&35FDUGV$¿HOGVHUYLFHFRPSRQHQWLVUHTXLUHGDVSDUWRI study of nation states, ideologies, and the New Imperialism the course. The course is offered to all students and is graded on leading up to World War I. Special attention is paid to European a pass/fail basis. religious, cultural, philosophical, political, social, and economic transformations that shaped the modern world. HE 355 Exercise Physiology (3) Exercise physiology is the study of how the body adapts to the HI 240 History of the Middle East DFXWHDQGFKURQLFVWUHVVRISK\VLFDODFWLYLW\,WGHYHORSVDEDVLF $VXUYH\RIWKHKLVWRU\RIWKH,VODPLF0LGGOH(DVWDQG1RUWK understanding of how the body works by incorporating anatomy, Africa with special attention paid to the Arab expansion of motor learning, kinesiology, biomechanics, and systematic WKHPHGLHYDOSHULRGWKH2WWRPDQ(PSLUHDQGSDUWLFXODUO\WKH physiology. Pre-requisite: BI 235 and BI 236 modern Middle East in crisis. Offered in odd alternate years. HE 375 Secondary School Health Field Placement (1) HI 250 History of Asia 7KLVFRXUVHSURYLGHKDQGVRQH[SHULHQFHIRUKHDOWKHGXFDWLRQ $VXUYH\RIWKHHDUO\KLVWRULHVRI&KLQDDQG,QGLDIROORZHG VWXGHQWVLQVHFRQGDU\VFKRROKHDOWKHQYLURQPHQWV6WXGHQWVDUH E\PDMRUGHYHORSPHQWVLQ$VLDEHIRUHWKHPRGHUQSHULRGDQG UHTXLUHGWRREVHUYHDQGWKHQOHDGOHDUQLQJDFWLYLWLHVWKURXJKRXW culminating with the emergence of modern Japan, India’s struggle WKHVHPHVWHUDWDQDVVLJQHGVHFRQGDU\VFKRROKHDOWK¿HOG IRULQGHSHQGHQFH&KLQD¶VRQJRLQJWKFHQWXU\UHYROXWLRQDQG placement. This course is for health education candidates only the crisis in southeast Asia. Offered in odd alternate years. and must be taken with HE 376. HI 260 Modern Latin America (3) HE376 School Health Instruction for Middle School through $QLQGHSWKVXUYH\RI/DWLQ$PHULFDVLQFHLQGHSHQGHQFHZLWK 12 (2) special attention paid to the history of Mexico and Central 7KLVFRXUVHDQGLWVDVVRFLDWHG¿HOGH[SHULHQFHZLOOIRFXVRQ America. A thematic approach will be used, with a focus on teaching and learning experiences in secondary health instruction. the social and cultural aspects of this tumultuous time in Latin 6WXGHQWVZLOOLQYHVWLJDWHFXUULFXOXPGHYHORSPHQWFODVVURRP American history. organization, and teaching methodology in health education for middle school through high school. Practical application HI 270 Black History in the Americas (3) RIWHDFKLQJSULQFLSOHVLQDVFKRROVHWWLQJZLOOEHSURYLGHGDW $VXUYH\RI$IULFDQ$PHULFDQKLVWRU\IURPVODYHU\WRWKH RXUSDUWQHUVKLSVFKRRO7KLVFRXUVHDQG¿HOGH[SHULHQFHDUH SUHVHQW0DMRUHYHQWVSHULRGVDQGWKHPHVLQ$IULFDQ$PHULFDQ prerequisites to student teaching and are offered each spring KLVWRU\ZLOOEHGLVFXVVHGZLWKWKHIRFXVQRWRQWKHYLFWLPL]DWLRQ VHPHVWHU2QO\VWXGHQWVWKDWKDYHEHHQDFFHSWHGLQWRWKH7HDFKHU RIDUDFHEXWRQWKHVXUYLYDODQGSHUVHYHUDQFHRIDFXOWXUHDQGWKH Education Program may enroll in this course. contributions of this culture to the American mosaic. HE 481 Organization and Administration of Health, Physical HI 311 Colonial America (3) Course Descriptions 72 An in-depth study of the Colonial Era, from European contact +LVWRU\RIWKH2KLRDUHDIURPSUHKLVWRULFWRSRVW&LYLO:DU WKURXJKWKH5HYROXWLRQDU\:DU7KHPHVWKDWZLOOEHLQYHVWLJDWHG WLPHV$VXUYH\RIUHJLRQDOJHRJUDSK\DQGHFRQRPLFDQGVRFLDO will be Indian-white relations, the role of women and minorities LQÀXHQFHV2IIHUHGLQHYHQDOWHUQDWH\HDUV in colonial America, and the social and cultural institutions, which helped shape American culture and history. HI 371 History of Russia and the Soviet Union I Part one of a two-semester sequence, History of Russia deals with HI 320 American Indian History to 1865 (3) HDUO\5XVVLDQKLVWRU\IURPWKHIRXQGLQJRIWKH.LHYDQ5XV¶VWDWH A study of the historic Indians of eastern United States with WKURXJKWKHJURZWKRI0XVFRY\WKHHPHUJHQFHRI5XVVLDXQGHU emphasis in linguistic and tribal location, social and political 3HWHUWKH*UHDWDQGWKHGHYHORSPHQWRI,PSHULDO5XVVLDXQWLOLWV RUJDQL]DWLRQDQGZKLWHUHGUHODWLRQV6SHFL¿FOLQJXLVWLFJURXSV GHPLVHLQWKHJUHDW5XVVLDQ5HYROXWLRQ and tribes will be used as type models. HI 372 History of Russia and The Soviet Union II HI 321 American Indian History since the Civil War (3) Part two of a two-semester sequence deals with the Russian $VWXG\RIWKHPDMRUWKHPHVDQGHYHQWVLQ$PHULFDQ,QGLDQ 5HYROXWLRQLQGHWDLOLQFOXGLQJWKHDVSLUDWLRQVDQGSUREOHPV KLVWRU\VLQFHLQFOXGLQJWKHUHVHUYDWLRQV\VWHPDOORWPHQW RIWKHUHYROXWLRQDULHVWKHFUHDWLRQRIWKH6RYLHW8QLRQWKH WKHULVHRISDQ,QGLDQUHIRUPPRYHPHQWVVXFKDVWKH6RFLHW\ Communist experiment of the 1920s, the horrors of Stalinist of American Indians, the implementation of the Indian Russia, World War II, and the post-war clash of superpowers. 5HRUJDQL]DWLRQ$FWWHUPLQDWLRQDQGWKHULVHRI1DWLYH$PHULFDQ 7KHFRXUVHIRFXVHVRQWKHDFKLHYHPHQWVDQGIDLOXUHVRIWKH DFWLYLVPLQWKH VDQG V$QHWKQRKLVWRULFDODSSURDFK 6RYLHW8QLRQGRZQWRWKHFROODSVHRIWKH6RYLHWUHJLPHDQGWKH will be used, and sources from anthropology, literature, and emergence of new Russia. KLVWRU\ZLOOEHFRPELQHGWRSURYLGHDPRUHFRPSOHWHSLFWXUHRI 1DWLYH$PHULFDQKLVWRU\GXULQJWKLVSHULRG HI 395 Special Topics Among others, the following courses may be offered periodically HI 341 Twentieth Century World History I (3) as special topic courses: 3DUWRQHRIDWZRVHPHVWHUVHTXHQFH WKLVFRXUVHH[DPLQHV Modern Latin America WKHPDMRUWKHPHVDQGHYHQWVRIWKHWKFHQWXU\XSWRWKHHYH The History of Women in America of World War II. These include the focus on imperialism that Trans-Mississippi West swept the world around the turn of the century, the politics and 7KH&LYLO:DU diplomacy that led into World War I, the changes the war caused Social and Cultural History of the United States in culture and society, and the disillusionment of the 1920s. Germany, from Bismark to Hitler The challenges of the 1930s, including the world-wide Great Depression, the rise of fascism, and the failures of diplomacy and HI 398 Historical Methods and Public History (3) the imperialism which contributed to the start of World War II. 7KLVFRXUVHLQWURGXFHVDQGUHLQIRUFHVWKHPDMRUVNLOOVDQG PHWKRGVRIWKHKLVWRULFDOSURIHVVLRQ7RSLFVFRYHUHGLQFOXGH HI 342 Twentieth Century World History II (3) historical writing and the proper documentation of that writing, Part two of a two-semester sequence, this course begins with DGYDQFHGUHVHDUFKVNLOOVRUDOLQWHUYLHZWHFKQLTXHVDQGEDVLF :RUOG:DU,,DQGFRQWLQXHVWRWKHSUHVHQW0DMRUWKHPHVDQG DUFKLYHVDQGUHFRUGVPDQDJHPHQW$QLPSRUWDQWFRPSRQHQWRI WRSLFVFRYHUHGLQFOXGH:RUOG:DU,,DQGWKHHFRQRPLFSROLWLFDO WKLVFRXUVHLVWKHSUDFWLFDODSSOLFDWLRQRIWKHVHVNLOOVLQDUHOHYDQW and social changes that it caused, as well as the struggles of VHUYLFHOHDUQLQJRSSRUWXQLW\LQWKHFRPPXQLW\ UHEXLOGLQJDZDUWRUQZRUOG0DMRUEDWWOHVRIWKH&ROG:DUZLOO be discussed in some depth, including the decades-long war in HI 496 Readings Vietnam, and the continuing struggles in Europe. The Through a readings program, students may explore the literature independence and rise of Third World nations, as well as the RIDVSHFL¿F¿HOGLQSUHSDUDWLRQIRUDODWHULQGHSHQGHQWUHVHDUFK increasing economic and political importance of Japan and the SURMHFWFDQ¿OODYRLGLQWKHLUEDFNJURXQGRUUHDGWKHOLWHUDWXUH 0LGGOH(DVWZLOODOVREHFRYHUHG(XURSHDQUHIRUPIURPWKH RIDVXEMHFWIRULWVRZQYDOXH7KHSURJUDPLVGLUHFWHGWRZDUG EEC to the fall of the Berlin Wall and the self-destruction of the VRPHVSHFL¿FJRDORUSXUSRVH7KHVWXGHQWLVH[SHFWHGWRVXEPLW 6RYLHW8QLRQDVDVXSHUSRZHUZLOODOVREHGLVFXVVHGDVZLOOWKH DSSOLFDWLRQWKURXJKDIDFXOW\VXSHUYLVRU 8QLWHG6WDWHV FKDQJLQJUROHLQZRUOGDIIDLUVGXULQJWKLVSHULRG HI 498 Seminar: Senior Capstone Experience HI 336 History of the Constitution In a seminar for credit, the faculty leader selects a topic or theme 7KHEDFNJURXQGRIRXUFRQVWLWXWLRQDOGHYHORSPHQWIURPQDWXUDO which is published in the regular schedule. The student works law to the present. Offered in odd alternate years. independently to a greater degree than in a regular course. A seminar meets on a regular basis for discussion of materials HI 345 The Ohio Area UHODWLYHWRWKHWRSLF HI 199, 299, 399, 499 Independent Research Course Descriptions 73 ,QGHSHQGHQWUHVHDUFKPD\EHHLWKHUSURMHFWRUUHVHDUFKRULHQWHG repetition structures, arrays and pointers. Prerequisites: IT 110 6XFKWRSLFVDUHQRWDQRUPDOSDUWRIWKHFXUULFXOXPDQGVHUYHWZR QHHGV ¿UVWWKHVWXGHQWLQYHVWLJDWHVDQDUHDRIVSHFLDOLQWHUHVW IT 130 Database Management (3) and second, the student works closely with a faculty member in This course is an introduction to database design and user SODQQLQJH[HFXWLQJDQGHYDOXDWLQJWKHSURJUDP interfaces. IT introduces the concept of normal forms, table structure, keys, queries, forms, reports and relational database Information Technology concepts. IT 100 Computer Literacy (3) An introduction to word processing, spreadsheets, and IT 210 Internet Programming I (3) presentation software integrating Internet concepts. This class This course is an in-depth study of HTML encoding for web browsers. Emphasis will be placed upon compliance with the GRHVQRWFRXQWWRZDUGVHLWKHUWKH,7PDMRURUPLQRU current accepted standards. Prerequisites: IT 120 or consent of IT 101 Internet Fundamentals (1) instructor. 7KLVPRGXOHFRYHUVEDVLF,QWHUQHWDFFHVVVNLOOV HPDLOJRSKHU IT 220 Internet Programming II (3) IWSWHOQHWDQGWKHZRUOGZLGHZHE6WXGHQWVDOVRGHYHORSEDVLF Internet searching skills using popular web browser software.. 7KLVFRXUVHLVDFRQWLQXDWLRQRI,7 ,QWHUQHW3URJUDPPLQJ , ,WLQFOXGHVDGYDQFHGWRSLFVVXFKDV;0/&DVFDGLQJ6W\OH IT 102 Word Processing/ Clip Art Skills (1) 6KHHWVDQG'RFXPHQW7\SH'H¿QLWLRQV(PSKDVLVZLOOEHSODFHG This module introduces the concepts for creating and enhancing upon the integration of dynamic data into Internet information. word processing documents on microcomputers. Students create Prerequisites: IT 130, IT 210. UHSRUWVUHVXPHZLWKFRYHUOHWWHUDQGÀ\HUVZLWKFOLSDUW IT 230 Advanced Topics in Information Technology (3) IT 103 Spreadsheet Skills (1) This class is an in-depth exploration of a current information This module introduces the concepts for designing and using Technology topic. Topics will be decided on a yearly basis. spreadsheets on microcomputers. Students create worksheets, Prerequisites: Consent of instructor. graphs, and learn to perform “what is” analyses. IT 310 Algorithms and Data Structures (3) IT 104 Presentation Skills (1) Algorithms and data structures are analyzed in their use of both This module introduces the concepts for designing and using pre- WLPHDQGVSDFHDQGWKHFKRLFHRIGDWDVWUXFWXUHLQSUREOHPVROY- ing is studied. Theoretical issues, such as optimization, best - and VHQWDWLRQVRIWZDUH 3RZHU3RLQW ZLWKPLFURFRPSXWHUV6WXGHQWV create electronic slides and organize complete presentations. worst-case performance and limitations of algorithms are studied, as well as implementation issues. Prerequisite: IT 120 IT 106 Spreadsheets Progress from basic spreadsheet operations on microcomputers IT 320 Network Fundamentals (3) WRPRUHLQWHUPHGLDWHDSSOLFDWLRQV/HDUQWRHI¿FLHQWO\SURGXFH 7KLVFRXUVHLVDVWXG\RIGDWDFRPPXQLFDWLRQFRQFHSWV QHWZRUN worksheets. After mastering the basic feature of creating, editing WRSRORJLHV WUDQVPLVVLRQPHGLD ZLUHOHVVWUDQVPLVVLRQ QHWZRUN DQGIRUPDWWLQJDVSUHDGVKHHWZRUNZLWKPRUHDGYDQFHGIRUPXODV DFFHVVFRQWURO FRPPXQLFDWLRQSURWRFROV QHWZRUNDUFKLWHFWXUH and functions, perform what-if analysis, create graphs and data- LANs, and WANs. Prerequisite: IT 110. Offered in Spring of bases, and work with macros. Use spreadsheets to assist in the HYHQ\HDUV decision-making process. IT 330 Information Technology Ethics (3) IT 110 Programming I (3) This class brings together philosophy, law, and technology to 7KLVFRXUVHLVDQLQWURGXFWLRQWRSUREOHPVROYLQJDQGDOJRULWKP SURYLGHDULJRURXVLQGHSWKH[SORUDWLRQDQGDQDO\VLVRIDEURDG GHVLJQ7RSLFVLQFOXGHREMHFWRULHQWHGGHVLJQYDULDEOHVDQGWKHLU range of topics regarding the ethical implications of widespread scope, decision structures, and logical and comparison operators. XVHRIFRPSXWHUWHFKQRORJ\'HVLJQHGWRSURYRNHVWXGHQWVWR The primary emphasis is on programming as a methodology UHÀHFWXSRQWKHVRFLDODQGHWKLFDOUDPL¿FDWLRQVRIPDQDJLQJ IRUSUREOHPVROYLQJLQFOXGLQJ WKHSUHFLVHVSHFL¿FDWLRQRID information. Prerequisite: IT 120 problem, the design of its solution, the encoding of that solution DQGWHVWLQJDQGGHEXJJLQJ3UHUHTXLVLWHV 0$RUHTXLYDOHQW IT 390 Internship/Cooperative Education (3) &RRSHUDWLYHHGXFDWLRQLVDVXSHUYLVHGZRUNH[SHULHQFHUH- IT 120 Programming II (3) ODWHGWRDVWXGHQW¶VPDMRURU¿HOGRILQWHUHVW$VWXGHQWVKRXOG 7KLVFRXUVHLVDFRQWLQXDWLRQRI,7 3URJUDPPLQJ, DQG be employed full-time with pay and should not be enrolled in HPSKDVL]HVSUREOHPVROYLQJDQGDOJRULWKPGHVLJQ7KLVFRXUVH FRYHUVVXFKFRQFHSWVDVREMHFWRULHQWHGGHVLJQGHFLVLRQDQG Course Descriptions 74 other courses except by special permission of the coordinator and Egyptian, Greek, Chinese, Hindu, Arabian, and Modern. RIFRRSHUDWLYHHGXFDWLRQ$VWXGHQWPD\HDUQXSWRFUHGLWV 6LJQL¿FDQWVWDJHVLQWKHGHYHORSPHQWRIGLIIHUHQWEUDQFKHVRI XSRQFRPSOHWLRQRIWZRWKUHHPRQWKVXPPHUWHUPV IRXUFUHGLWV mathematics, such as geometry, algebra, and calculus. Ancient HDFK DQGRQHVL[PRQWKLQWHUQVKLS HLJKWFUHGLWV 2WKHUZRUN SUREOHPVROYLQJWHFKQLTXHVDVZHOODVFRQWULEXWLRQVIURP DUUDQJHPHQWVPXVWEHDSSURYHGE\WKHFRRUGLQDWRURIFRRSHUDWLYH XQGHUUHSUHVHQWHGJURXSVDQGIURPGLYHUVHFXOWXUHVZLOOEH HGXFDWLRQDQGWKH5HJLVWUDU )URP%$GHVFULSWLRQ 3UHUHTXLVLWH explored. Prerequisite: MA 201. Offered in odd alternate years. ,7PDMRUDQGMXQLRUVWDWXV MA 301 Linear Algebra (4) IT 410 Human Computer Interaction (3) 9HFWRUVDQGYHFWRUVSDFHVOLQHDUWUDQVIRUPDWLRQVLVRPRUSKLVP This course is a study in user interface design and human- PDWUL[DOJHEUDPDWUL[HLJHQYHFWRUVDQGGHWHUPLQDQWV computer interaction. Emphasis is on HCI as an interdisciplinary Prerequisite: one semester of calculus or permission of ¿HOG7RSLFVFRYHUHGLQFOXGHFRJQLWLYHIUDPHZRUNVSHUFHSWLRQ instructor. Offered in odd alternate years. and representation, attention and memory, interface metaphors and conceptual models. Prerequisites: Junior status IT. Offered MA 302 Modern Abstract Algebra (4) LQVSULQJRIHYHQ\HDUV A study of algebraic structures. An introduction to groups, rings, LQWHJUDOGRPDLQVDQG¿HOGVH[DPLQLQJERWKFRQFUHWHH[DPSOHV IT 499 Capstone – Software Engineering (3) and axiomatic structure. Prerequisite: two semesters of calculus This course is an in-depth study of all aspects of the software RUSHUPLVVLRQRILQVWUXFWRU2IIHUHGLQHYHQDOWHUQDWH\HDUV GHYHORSPHQWSURFHVV XVHUUHTXLUHPHQWVVSHFL¿FDWLRQVGHVLJQ coding, testing, maintenance, documentation, management. De- MA 304 Modern Geometry (4) signed as the capstone class for Information Technology. Prereq- A re-examination of Euclidean geometry and an introduction to uisite: IT 310, 330. new geometries including classical non-Euclidean. Geometry is examined both as an axiomatic system and as a group of transformations. The understanding and application of the Mathematics process of measurement is included. Prerequisite: calculus or MA 104 Intermediate Algebra permission of the instructor. Offered in odd alternate years. Intermediate algebra, including algebraic operations on polynomials and rational expressions, solutions of linear MA 305 Discrete Mathematical Structures (3) algebraic equations, solutions of quadratic equations by factoring Topics from graph theory, combinatorics, logic and set theory. and the quadratic formula, inequalities, and systems of equations. Includes an introduction to proof including proof by induction, ,QWHQGHGIRUVWXGHQWVZKRQHHGWRLPSURYHWKHLUVNLOOVLQDOJHEUD an examination of Boolean algebras, and a study of algorithms and for those who need to meet the graduation requirement in including "big O" notation. Prerequisite: MA 106. Offered in PDWKHPDWLFV'RHVQRWDSSO\WRWKHPDWKHPDWLFVPDMRURUPLQRU HYHQDOWHUQDWH\HDUV Prerequisite: one year of high school algebra with a minimum grade of C- or GS 098. MA 306 Probability and Statistics (4) An examination of probability both in theory and application, MA 106 Pre-Calculus Mathematics (4) JUDSKLFDODQGQXPHULFDODQDO\VLVRIGDWDUDQGRPYDULDEOHV Topics in algebra, trigonometry, and functions that are essential probability distributions, estimation, hypothesis testing and linear IRUVXFFHVVLQFDOFXOXV,QWHQGHGIRUPDMRUVLQPDWKHPDWLFV regression. Emphasis on computer and handheld technology. computer science, natural science, and others who will go into the Prerequisite: one semester calculus and Math 305. Offered in FDOFXOXVVHTXHQFH&UHGLWZLOODSSO\WRWKHPDWKHPDWLFVPDMRU HYHQDOWHUQDWH\HDUV Prerequisite: MA 104 with grade of "C-" or better, or satisfactory result on the placement test. MA 401 Differential Equations (4) Methods of solution of ordinary differential equations, numerical MA 201, 202, 203 Analytical Geometry and Calculus I, II, III computation and estimation techniques extended to algebraic (4,4,4) expressions, selected applications, Laplace transforms and power $WKUHHFRXUVHVHTXHQFHFRYHULQJOLPLWVGHULYDWLYHV series solutions to equations, fundamental matrix solutions, and DQWLGHULYDWLYHVDQGWKHGH¿QLWHLQWHJUDOHOHPHQWDU\YHFWRU series solutions. Prerequisite: MA 203. DQDO\VLVLQ¿QLWHVHULHVUHODWHGWRSLFVLQDQDO\WLFJHRPHWU\ and selected relationships within mathematics and connect MA 405 Operations Research PDWKHPDWLFVWRVFLHQWL¿FDSSOLFDWLRQVDQGWRRWKHUGLVFLSOLQHVLQ Mathematical programming and models. Topics will include UHDOZRUOGVLWXDWLRQV3UHUHTXLVLWH 0$RUHTXLYDOHQW linear programming, integer programming, network models, JDPHWKHRU\DQG0DUNRYFKDLQV7KHPDLQHPSKDVLVRIWKH MA 300 The History of Mathematics (3) course will be to introduce students to the concepts of building 0DWKHPDWLFVDVLWH[LVWHGDWYDULRXVVWDJHVRIKLVWRU\%DE\ORQLDQ PRGHOVDQGDSSO\LQJWKHVHWRDYDULHW\RIVLWXDWLRQV6WXGHQWVZLOO Course Descriptions 75 be expected to build and implement models of their own using FI 350. computer simulation for solutions. Prerequisite: MA 301, IT 110 RUHTXLYDOHQW2IIHUHGLQRGGDOWHUQDWH\HDUV MG 370 Management Information Systems This course addresses the changing role of information MA 410 Topics in Applied Mathematics technology and the management of information systems and $SSOLFDWLRQVRIDGYDQFHGPDWKHPDWLFVLQFOXGLQJ)RXULHUVHULHV WHFKQRORJ\LQWRGD\ VRUJDQL]DWLRQV,WLVGHVLJQHGWREULQJ DQG%RXQGDU\YDOXHSUREOHPV*UHHQ¶VIXQFWLRQVFDOFXOXVRI WRJHWKHULQRQHOHDUQLQJH[SHULHQFHWKHYDULRXVFRQFHSWVRI YDULDWLRQV6WXUP/LRXYLOOHHLJHQYDOXHSUREOHPVDQGWHQVRU PDQDJLQJLQIRUPDWLRQV\VWHPV 0,6 DQGLQIRUPDWLRQWHFKQRORJ\ DQDO\VLV3UHUHTXLVLWH 0$ 0$UHFRPPHQGHG ,7 7KLVFRXUVHUHSUHVHQWVDQLQVWLWXWLRQDODVVHVVPHQWFRXUVH Prerequisites: MG 331, AC 221, IT 106. MA 490 Senior Capstone Project (3-4) $VHQLRUSURMHFWLVUHTXLUHGRIDOOPDWKHPDWLFVPDMRUV(DFK MG 450 Seminar in Management VWXGHQWZLOOFRPSOHWHDQLQGHSHQGHQWSURMHFWXQGHUWKH In-depth analysis of issues facing contemporary managers. Use VXSHUYLVLRQRIDPDWKHPDWLFVRUSK\VLFVIDFXOW\PHPEHUDQG of supplemental business sources to analyze and forecast trends present the results to the mathematics faculty and students. that will affect managers in the 21st century. Prerequisites: Busi- 6HQLRUVHQJDJHGLQVHQLRUSURMHFWVDUHH[SHFWHGWRDWWHQG ness Core, MG 340, and MG 360. DOOSUHVHQWDWLRQV)RUPDWKHPDWLFVHGXFDWLRQPDMRUVWKH\ LQYHVWLJDWHXVLQJDSUREOHPVROYLQJDSSURDFKWRWKHLQYHVWLJDWLRQ MG 470 Organizational Leadership and demonstrate an understanding of mathematical content using $QDQDO\VLVRIYDULRXVWKHRULHVDQGDSSURDFKHV7KHFRXUVH HYHU\GD\PDWKHPDWLFDOODQJXDJH7KH\PXVWEHDEOHWRPDNHDQG LQFOXGHVVNLOOGHYHORSPHQWH[SHULHQWLDODFWLYLWLHVWKHRUHWLFDO HYDOXDWHPDWKHPDWLFDOFRQMHFWXUHDQGDUJXPHQWVDQGYDOLGDWH FRQVWUXFWVDQGJXHVWVSHDNHUVZKRDUHOHDGHUVLQDYDULHW\RIVHW- their own mathematical thinking. tings. Prerequisites: Business Core, MG 340, and MG 360. Management MG 485 Small Business Management MG 331 Principles of Management 3UDFWLFDOSUREOHPVLQRSHUDWLRQVPDUNHWLQJDQG¿QDQFHIDFLQJ Basic principles of management with an emphasis on the WKHVPDOOEXVLQHVVPDQRUHQWUHSUHQHXU UHDGLQJVFDVHVWXGLHV human relations approach. Includes studies of organizational DQGFRQVXOWLQJSURMHFWVZLWKORFDO¿UPV3UHUHTXLVLWHV MXQLRU GHYHORSPHQWLVVXHVSUDFWLFDODSSOLFDWLRQVRIPRWLYDWLRQDOWKHRU\ standing and permission from instructor. DQGOHDGHUVKLSDSSURDFKHVDOOUHODWLYHWRERWKSUR¿WDQGQRWIRU SUR¿WRUJDQL]DWLRQV3UHUHTXLVLWH MXQLRUVWDQGLQJ MG 486 Organizational Development 7KLVFRXUVHH[DPLQHVWKHFRQFHSWVRIFKDQJHGHYHORSPHQWDQG WUDQVIRUPDWLRQ3URYLGHVWKHVWXGHQWZLWKDEDVLFXQGHUVWDQGLQJ MG 332 Human Resource Management of organizational structure and design, processes of organiza- A study of the basic functions associated with human resource tional renewal, factors affecting the outcome of change efforts, PDQDJHPHQWLQFOXGLQJUHFUXLWPHQWVHOHFWLRQGHYHORSPHQWDQG and system strategies for transforming organizations. The course FRPSHQVDWLRQRISHUVRQQHOSHUIRUPDQFHHYDOXDWLRQTXDOLW\RI ZLOOVWXG\WKHHIIHFWVRQHPSOR\HHEHKDYLRUVGXULQJWKHFKDQJH work life, and employment practices and policies. Prerequisite: process. Prerequisites: MG 331, MG 332, and MG 340. MXQLRUVWDQGLQJDQGFRPSOHWLRQRI0* MG 495 Current Trends in Management MG 340 Teamwork and Teambuilding This course will examine the current issues and trends affecting 7KLVFRXUVHXVHVDFROODERUDWLYHOHDUQLQJHQYLURQPHQWWRVWXG\ WKHPDQDJHPHQWRIRUJDQL]DWLRQV7RSLFVRIGLVFXVVLRQZLOOYDU\ WHDPGHYHORSPHQWDQGFKDUDFWHULVWLFVZKLOHDOVRH[SORULQJ DVWKHPDQDJHPHQW¿HOGFKDQJHV/HDGLQJVFKRODUVLQWKH¿HOG LQWHUSHUVRQDOLVVXHVDQGSHUVRQDOIHHOLQJVLQJURXSLQYROYHPHQW will be studied. Prerequisites: Business Core. The course setting becomes a laboratory for group interaction ZKHUHRQH¶VHIIHFWLYHQHVVDVDWHDPPHPEHULQFUHDVHV7KH FRXUVHSURYLGHVH[SODQDWLRQVRIWKHOHDGHU¶VUROHLQLQLWLDWLQJ Marketing building and maintaining teams. The course teaches management MK 340 Principles of Marketing RIFRQÀLFWEHWZHHQDQGZLWKLQJURXSVDQGGHFLVLRQPDNLQJDQG $QLQWURGXFWRU\VXUYH\RIWKHPDUNHWLQJIXQFWLRQ SURGXFW SUREOHPVROYLQJVW\OHV3UHUHTXLVLWHV 0* GHVLJQGLVWULEXWLRQSULFLQJDGYHUWLVLQJDQGSHUVRQDOVHOOLQJ MG 360 Global Issues in Management MK 341 Advertising This course examines the management of international opera- WLRQVDWERWKWKHRSHUDWLRQDODQGVWUDWHJLFOHYHOV$IUDPHZRUN for understanding human resource and cultural issues related to LQWHUQDWLRQDOPDQDJHPHQW/HFWXUHVGLVFXVVLRQJURXSSURMHFWV DQGJXHVWVSHDNHUYLVLWV3UHUHTXLVLWHV 0*0*DQG Course Descriptions 76 5ROHRIDGYHUWLVLQJLQEXVLQHVVDQGVRFLHW\ FRQFHSWVDQGVWUDWHJ\ NS 198 Seminar LQWKHDGPLQLVWUDWLRQRIDGYHUWLVLQJSURJUDPV EXGJHWVDQGPHGLD A regularly scheduled series of seminars is an integral part of VHOHFWLRQ HYDOXDWLRQRIDGYHUWLVLQJHIIHFWLYHQHVV3UHUHTXLVLWH the Natural Science program. The purpose of the seminars is to MK 340. broaden the student intellectually by exposure to presentations by RXWVLGHVSHDNHUVIDFXOW\PHPEHUVDQGVWXGHQWVZKRKDYHKDG MK 344 Retail Management VLJQL¿FDQW¿HOGH[SHULHQFHV)RXUVHPHVWHUV FUHGLWKRXUV RI Principles of retailing as applied to the marketing of goods HQUROOPHQWDUHUHTXLUHGRI1DWXUDO6FLHQFHPDMRUV$WWHQGDQFHE\ DQGVHUYLFHVWRXOWLPDWHFRQVXPHUV6WRUHORFDWLRQFRQVXPHU DOO1DWXUDO6FLHQFHPDMRUVLVJUHDWO\HQFRXUDJHG EHKDYLRUSURPRWLRQDQGSHUVRQDOVHOOLQJVNLOOVDUHH[DPLQHG Purchasing practices and price setting for retail managers. NS 200/300 Earth in the Cosmos Prerequisite: MK 340. 7KLVFODVVDOORZVIRUWKHH[SORUDWLRQRIWKHVFLHQWL¿FPHWKRGWKH GHYHORSPHQWRIK\SRWKHVHVDQGDQXQGHUVWDQGLQJRIWKHSK\VLFDO MK 348 Salesmanship XQLYHUVHWKURXJKREVHUYDWLRQLQYHVWLJDWLRQDQGLQIHUHQFH7KH A study of basic personal selling techniques: steps in the selling students will gain an appreciation for the physical mechanisms SURFHVVEX\HUEHKDYLRUREOLJDWLRQVDQGSHUVRQDOLW\IDFWRUV RIWKHXQLYHUVHDQGWKHV\QHUJLVWLFOLQNVEHWZHHQWKHVHSURFHVVHV in the selling process. Prerequisite: MK 340. Offered in odd the natural sciences, and human culture. alternate years. NS 201/301 The Development of Life on Earth MK 442 Marketing Management This course is designed to meet the life science requirement for &DVHVWXGLHVLQYROYLQJWKHGHYHORSPHQWDQGPDUNHWLQJRID QRQVFLHQFHPDMRUV$UHDVRIHPSKDVLVDUHWKHFHOOLQKHULWDQFH YDULHW\RISURGXFWVDQGVHUYLFHV PDMRUWDVNVDQGGHFLVLRQV HYROXWLRQDQLPDODQDWRP\DQGSK\VLRORJ\DQGHFRORJ\ LQYROYHGLQWKHPDUNHWLQJSURFHVV3UHUHTXLVLWH MXQLRUVWDQGLQJ 3DUWLFXODUDWWHQWLRQZLOOEHJLYHQWRWKHKXPDQVSHFLHVDQGKRZLW DQGVL[FUHGLWVLQPDUNHWLQJ2IIHUHGLQHYHQDOWHUQDWH\HDUV ¿WVLQWKHHQYLURQPHQW$ODERUDWRU\FRPSRQHQWLVUHTXLUHG MK 449 Marketing Research NS 199, 299, 399 Independent Research 0HWKRGVRISODQQLQJDQGFRQGXFWLQJPDUNHWUHVHDUFKSURMHFWV ,QGHSHQGHQWUHVHDUFKPD\EHHLWKHUSURMHFWRUUHVHDUFKRULHQWHG analysis and interpretation of research data. Prerequisite: BA 212 6XFKWRSLFVDUHQRWDQRUPDOSDUWRIWKHFXUULFXOXPDQGVHUYHWZR and 240. Offered in odd alternate years. QHHGV ¿UVWWKHVWXGHQWLQYHVWLJDWHVDQDUHDRIVSHFLDOLQWHUHVW and second, the student works closely with a faculty member in Music SODQQLQJH[HFXWLQJDQGHYDOXDWLQJWKHSURJUDP MU 138, 338 Private Applied Music 3ULYDWHDSSOLHGPXVLFUHTXLUHVWKHDSSURYDORIWKHLQVWUXFWRU NS 390 Art of the Exam (1) Enrollment for one credit entitles the student to 14 one-half hour A one credit hour course designed to prepare preprofessional lessons on a weekly basis, and the student is required to practice VFLHQFHPDMRUVIRUWKHULJRUVRIHQWUDQFHH[DPV$WWHQWLRQLV ¿YHKRXUVSHUZHHN6WXGHQWVPXVWKDYHDFFHVVWRSUDFWLFHVSDFH focused on GRE and MCAT formats. Topics include test tactics 3UDFWLFHURRPVDQGLQVWUXPHQWVDUHDYDLODEOHIRUUHQWDO WRLPSURYHSHUIRUPDQFHRQWLPHGH[DPVUHDGLQJFRPSUHKHQVLRQ %2UJDQ '3LDQR )9RLFH DQGYRFDEXODU\DQGSUHSDUDWLRQIRUWKHVFLHQWL¿FSRUWLRQRIWKH GRE and MCAT tests. Actual timed exams including two hour MU 139, 339 Ensembles WHVWVDUHJLYHQJUDGHGDQGGLVFXVVHG3UHUHTXLVLWHV -XQLRURU Ensembles are restricted in enrollment and may require an senior status and permission of the instructor. Offered in odd audition with the director. alternate years. &&RQFHUW%DQG '&KDPEHU6LQJHUV ((QVHPEOHV NS 394 Cooperative Education or NS 391 Internship MU 195, 295, 395, 495 Special Topics 7KH1DWXUDO6FLHQFHIDFXOW\UHDOL]HWKHYDOXHRID¿HOGW\SH Special topics are usually designed by a faculty member. Possible experience in today’s educational curriculum. The faculty also WRSLFVFRXOGLQFOXGHVSHFL¿FFRPSRVHUVJHQUHRUSHULRGV UHDOL]HWKDWWRHQDEOHDVWXGHQWWRKDYHDYDOXDEOHHGXFDWLRQDO Offered on demand. experience at the on-site location, the basic courses which will allow the work experience to be an enlightening and expandable MU 199, 299, 399, 499 Independent Research SDUWRIHGXFDWLRQPXVWKDYHEHHQWDNHQ7KHIROORZLQJFULWHULD ,QGHSHQGHQWUHVHDUFKPD\EHHLWKHUSURMHFWRUUHVHDUFKRULHQWHG KDYHEHHQHVWDEOLVKHGE\WKH1DWXUDO6FLHQFHIDFXOW\IRUVWXGHQWV The student works closely with a faculty member in planning, GHVLULQJVFLHQFHFUHGLWZKLOHHQUROOHGLQFRRSHUDWLYHHGXFDWLRQ H[HFXWLQJDQGHYDOXDWLQJWKHSURJUDP RUDQLQWHUQVKLS 6WXGHQWVPXVWDFKLHYHMXQLRUVWDQGLQJ 6WXGHQWVPXVWQRWEHRQDFDGHPLFSUREDWLRQ 6WXGHQWVZLOO PHHWZLWKDSSURSULDWHVWDIIPHPEHUVRIWKH'LYLVLRQDQGSUHVHQW Natural Science a rationale indicating how the work experience will enhance their Course Descriptions 77 VFLHQFHHGXFDWLRQ,IWKHUDWLRQDOHIRUFRRSHUDWLYHHGXFDWLRQRU PE 122 Camp Counseling and Administration (3) DQLQWHUQVKLSLVDFFHSWDEOHDQGPHHWVWKHFULWHULDDERYHWKHVWDII 'HYHORSDNQRZOHGJHRIFDPSLQJVNLOOVWKDWLQFOXGHHYHU\WKLQJ ZLOODSSURYHWKHSURSRVDO8SRQFRPSOHWLRQRIWKHHGXFDWLRQDO IURPQDWXUHFUDIWVWRYDULRXVZDWHUFUDIWVNLOOV/HDUQWKHYDULRXV experience, the student will present a seminar for the faculty responsibilities and duties of required camp staff in a day camp and students as a part of a regularly scheduled Natural Science and extend camp settings. Identify with leadership process, seminar. Following the completion of the seminar presentation, RUJDQL]DWLRQVWUXFWXUHDQGSHUVRQQHOPDQDJHPHQW'HYHORSDQ the student will be graded. awareness to State and Federal Health and Safety Standards, and WKHLPSRUWDQFHRI¿VFDOPDQDJHPHQW NS 495 Readings Through a reading program, a student may explore the literature PE 129 Recreation Theory and Leadership (3) RIDVSHFL¿F¿HOGLQSUHSDUDWLRQIRUDODWHULQGHSHQGHQWUHVHDUFK 7KHGHYHORSPHQWRIUHFUHDWLRQOHDGHUVKLSWKURXJKWKHVWXG\RI SURMHFWRUFDQ¿OODYRLGLQKLVKHUEDFNJURXQG,QDOOFDVHVWKH JURXSG\QDPLFVDFWLYLWLHV,GHQWLI\ZLWKWKHYDULRXVOHDGHUVKLS SURJUDPLVGLUHFWHGWRZDUGVRPHVSHFL¿FJRDORUSXUSRVH7KH techniques as they relate to group dynamics. Study the history VWXGHQWPXVWDSSO\WKURXJKDIDFXOW\VXSHUYLVRU of recreation and how it has become important to all age group in WKHSUHVHQW%HFRPHDZDUHRISURIHVVLRQDOMRXUQDOVSURIHVVLRQDO NS 499 Senior Capstone Project RUJDQL]DWLRQVDQGDJHQFLHVDQGWKHLULQYROYHPHQWLQWKHPDQ\ $VHQLRUFDSVWRQHSURMHFWLVUHTXLUHGRIDOO1DWXUDO6FLHQFH aspects of recreation today. PDMRUVDQGFDQEHFRPSOHWHGE\RQHRIWKHIROORZLQJPHWKRGV 7KHVWXGHQWVKDOOFRPSOHWHDQLQGHSHQGHQWUHVHDUFKSURMHFWXQGHU PE 130 Fitness for Life (2) WKHVXSHUYLVLRQRID1DWXUDO6FLHQFHIDFXOW\PHPEHU'XULQJ Designed to increase students knowledge and appreciation of his/her senior year, the student will present the research during VNLOOUHODWHGDQGKHDOWKUHODWHG¿WQHVVSULQFLSOHV6WXGHQWVZLOO a Natural Science seminar. If circumstances preclude a student GHYHORSDQGDSSO\WKHLUNQRZOHGJHRIKHDOWK\OLIHVW\OHVWKURXJK IURPFRPSOHWLQJDQLQGHSHQGHQWUHVHDUFKSURMHFWWKHIROORZLQJ lecture and laboratory opportunities by writing about, and PHWKRGFDQEHXVHGWRIXO¿OOWKHUHTXLUHPHQW'XULQJWKHMXQLRU HQJDJLQJLQWKHLURZQ¿WQHVVSURJUDPVEDVHGRQSHUVRQDOQHHGV \HDUDVWXGHQWSUHSDUHVDOLWHUDWXUHDQDO\VLVDQGUHYLHZRID interests, and expectations. VSHFL¿FWRSLFDSSURYHGE\WZR1DWXUDO6FLHQFHIDFXOW\'XULQJ the senior year the student will present a Natural Science seminar PE131 Individual Fitness and Conditioning (1) FRYHULQJWKHWRSLF 7KLVFRXUVHLVGHVLJQHGWRSURPRWHLQGLYLGXDOSDUWLFLSDWLRQLQ ¿WQHVVDFWLYLWLHVWKDWZLOOPDLQWDLQRULQFUHDVHSHUVRQDOOHYHOV PXVFXODUVWUHQJWKPXVFXODUHQGXUDQFHPXVFXODUÀH[LELOLW\DQG FDUGLRYDVFXODUHQGXUDQFH7KHLQVWUXFWRUZLOOZRUNZLWKVWXGHQWV WRGHYHORSDVRXQGSK\VLFDO¿WQHVVUHJLPHQDQGZLOOVXSHUYLVH biweekly exercise sessions. Can be repeated up to a total of 3 hours for PE131, PE132, PE135 and PE138. PE132 Racket Sport Activities (1) Physical Education This course is designed to promote small group participation PE 117 Secondary School Activities LQ¿WQHVVDFWLYLWLHVWKDWLQYROYHUDFNHWVSRUWVVXFKDVWHQQLV 'HVLJQHGWRJLYHWKHSURVSHFWLYHVHFRQGDU\SK\VLFDOHGXFDWLRQ racquetball, badminton, or pickle ball. Students will learn about PDMRURUUHFUHDWLRQVSHFLDOLVWDQXQGHUVWDQGLQJRIIXQGDPHQWDO WKHUXOHVDQGVWUDWHJLHVLQYROYHGZLWKWKHVHUDFNHWVSRUWVDQGZLOO VSRUWVNLOOVPDWHULDOVDQGPHWKRGVRISUHVHQWLQJWKHYDULRXV KDYHWKHRSSRUWXQLW\WRSOD\WKHPWZLFHZHHNO\&DQEHUHSHDWHG skills. Emphasis will be placed on skill-learning through up to a total of 3 hours for PE131, PE132, PE135 and PE138. maximum participation. PE 135 Group Recreational Activities (1) PE 121 Foundations of Health Physical Education and Sport This course is designed to promote small and/or large group (3) SDUWLFLSDWLRQLQDYDULHW\RI¿WQHVVDFWLYLWLHVWKDWLQFOXGH The history and philosophy of health, physical education, and YROOH\EDOOEDVNHWEDOOVRFFHUDQGRWKHUFRXUWJDPHV6WXGHQWV sport are presented with career research and planning along ZLOOOHDUQDERXWWKHUXOHVDQGVWUDWHJLHVLQYROYHGZLWKLQWKHVH with the psychological and sociological implications of current JDPHVDQGZLOOKDYHWKHRSSRUWXQLW\WRSOD\WKHPWZLFHZHHNO\ physical education, health, and sport issues. Students are Can be repeated up to a total of 3 hours for PE131, PE132, PE135 LQWURGXFHGWRSURIHVVLRQDOVLQWKHLUPDMRUDUHDRIVWXG\7KH\ and PE138. will examine closely all professional organizations pertinent to their area of study. PE138 Individual Strength Training (1) 7KLVFRXUVHLVGHVLJQHGWRSURPRWHLQGLYLGXDOSDUWLFLSDWLRQLQ VWUHQJWKWUDLQLQJDFWLYLWLHVWKDWZLOOPDLQWDLQRULQFUHDVHSHUVRQDO Course Descriptions 78 OHYHOVRIPXVFXODUVWUHQJWKDQGSRZHU7KHLQVWUXFWRUZLOOZRUN 7KHVWXGHQWVZLOOOHDUQDERXWWKHLPSRUWDQFHRIGHYHORSLQJDQG ZLWKVWXGHQWVWRGHYHORSDVRXQGVWUHQJWKWUDLQLQJUHJLPHQDQG working with the IEP, after working with a number of testing and ZLOOVXSHUYLVHELZHHNO\H[HUFLVHVHVVLRQV&DQEHUHSHDWHGXSWR VFUHHQLQJGHYLFHV7KHUHLVD¿HOGVHUYLFHFRPSRQHQWDVSDUWRI a total of 3 hours for PE131, PE132, PE135 and PE138. the course requirements. PE 222 Pre K-3 (1) PE 260 Physical Education in Grades4-8(3) This course is to be taken concurrently with PE 224. The 3UHVHQWDWLRQRIVNLOOVDQGPHWKRGRORJ\LQDYDULHW\RIDFWLYLWLHV students will be placed in a partnership school, where they will suitable to meet the needs and characteristics of youngsters in be working with a physical education teacher at the Pre K-3 grades 4 through 8. The course will include tumbling, elementary OHYHO6WXGHQWVZLOOEHH[SHFWHGWRGHYHORSDQGRUJDQL]HSK\VLFDO J\PQDVWLFVUK\WKPLFDFWLYLWLHVWHDPDQGLQGLYLGXDOVSRUWV DFWLYLWLHVIRUWKHVHDJHOHYHOVDQGWKHDSSO\WKHDFWLYLWLHVWKURXJK DQGZHOOQHVV¿WQHVV(YDOXDWLRQDQGWHVWLQJSURFHGXUHVZLOOEH DSSURSULDWHPHWKRGRORJ\6WXGHQWVZLOOEHYLGHRWDSHGDQG LGHQWL¿HGIRUWKHYDULRXVDFWLYLWLHV VSHFL¿FDVVHVVPHQWVZLOOEHFDUULHGRXWE\WKHSK\VLFDOHGXFDWLRQ teacher and the college professor. PE 316 Secondary School Physical Education Field Placement (1) PE 224 Health and Physical Activity for Pre K-3 (3) 7KLVFRXUVHSURYLGHVKDQGVRQH[SHULHQFHIRUSK\VLFDOHGXFDWLRQ 3UHVHQWDWLRQRIDFWLYLWLHVDQGPHWKRGRORJ\UHODWHGWRKHDOWK VWXGHQWVLQVHFRQGDU\VFKRRO3(HQYLURQPHQWV6WXGHQWVDUH and physical education Pre K-3. The methods and selected UHTXLUHGWRREVHUYHDQGWKHQOHDGOHDUQLQJDFWLYLWLHVWKURXJKRXW VWUDWHJLHVZLOOPHHWWKHJURZWKDQGGHYHORSPHQWQHHGVRIWKHVH WKHVHPHVWHUDWDQDVVLJQHGVHFRQGDU\VFKRRO3(¿HOGSODFHPHQW FKLOGUHQ,QIRUPDWLRQLQFOXGHG EDVLFKHDOWK VDIHW\ QXWULWLRQ This course is for physical education candidates only and must be FRPPXQLFDEOHGLVHDVHDQGDEXVH EDVLFUK\WKPLFZRUN FUHDWLYH taken with PE 317. SOD\GUDPD ERG\PDQDJHPHQW ORFRPRWRUDQGQRQORFRPRWRU DQGPDQLSXODWLYHZRUN JDPHVRIORZRUJDQL]DWLRQ0XVWEH PE317 Secondary Physical Education (2) taken concurrently with PE 222. 7KLVFRXUVHDQGLWVDVVRFLDWHG¿HOGH[SHULHQFHZLOOIRFXV on teaching and learning experiences in secondary physical PE 237 Recreation for Special Populations HGXFDWLRQLQVWUXFWLRQ6WXGHQWVZLOOLQYHVWLJDWHFXUULFXOXP 'HVLJQHGWRSURYLGHWKHVWXGHQWZLWKDQXQGHUVWDQGLQJRIDFWLYLW\ GHYHORSPHQWFODVVURRPRUJDQL]DWLRQDQGWHDFKLQJPHWKRGRORJ\ DQDO\VLVDQGVHOHFWLRQWKHQSUHVHQWDWLRQWRDYDULHW\RIVSHFLDO in physical education for middle school through high school. SRSXODWLRQVDIWHUHYDOXDWLQJWKHUHVXOWVIURPWKHVFUHHQLQJVDQG Practical application of teaching principles in a school setting DSSUDLVDOV2IIHUHGLQWKHVSULQJHYHQDOWHUQDWH\HDUV ZLOOEHSURYLGHGDWRXUSDUWQHUVKLSVFKRRO7KLVFRXUVHDQG¿HOG experience are prerequisites to student teaching and are offered PE 238 Health and Physical Education for the Classroom HDFKVSULQJVHPHVWHU2QO\VWXGHQWVWKDWKDYHEHHQDFFHSWHGLQWR Teacher (2) the Teacher Education Program may enroll in this course. The course is designed for the Early Childhood Education teacher 3UH. ,WZLOOSURYLGHDQXQGHUVWDQGLQJRIWKHLPSRUWDQFHRI PE 334 Community First Aid and CPR (1) health and physical education for youngsters of this age. The stu- 0HHWVWKHUHTXLUHPHQWVIRU5HG&URVVFHUWL¿FDWLRQLQFRPPXQLW\ GHQWVZLOOGHYHORSOHDUQLQJJRDOVDQGLQVWUXFWLRQDOSODQVZLWKLQ ¿UVWDLGDQG&35LQFOXGLQJLQIDQWFKLOGDQGDGXOW&357KH both areas along with exploring school laws topics and current is- FRXUVHFRQFHQWUDWHVRQWKHLPPHGLDWHWHPSRUDU\FDUHJLYHQWR VXHV6WXGHQWVZLOODOVRKDYHWKHRSSRUWXQLW\WRWHDFK3(OHVVRQV WKHYLFWLP V RIDQDFFLGHQWRUVXGGHQLOOQHVVXQWLOSURIHVVLRQDO to Pre K youngsters on a weekly basis. Prerequisites ED 221 and help is secured. After satisfactorily completing the practical PY 225. UHTXLUHPHQWVDQGWHVWVVWXGHQWVZLOOUHFHLYHFRPPXQLW\¿UVWDLG DQG&35FDUGV$¿HOGVHUYLFHFRPSRQHQWLVUHTXLUHGDVSDUWRI PE 256 Evaluation and Measurement in Health and Physical the course. Education (3) 'HVLJQHGWRGHYHORSSKLORVRSK\DQGVNLOOVZLWKPHDVXUHPHQW PE 355 Exercise Physiology (3) HYDOXDWLRQDQGWHVWLQJLQKHDOWKSK\VLFDOHGXFDWLRQDQGVSRUW Exercise physiology is the study of how the body adapts to the 6WXGHQWVZLOOKDYHRSSRUWXQLWLHVWRFROOHFWDQGLQWHUSUHWGDWD DFXWHDQGFKURQLFVWUHVVRISK\VLFDODFWLYLW\,WGHYHORSVDEDVLF XVLQJGHVFULSWLYHDQGLQIHUHQWLDOVWDWLVWLFDOPHWKRGV0RVW understanding of how the body works by incorporating anatomy, DVVLJQPHQWVZLOOEHWDLORUHGWR¿WVHWWLQJVZLWKLQWKHVWXGHQW V motor learning, kinesiology, biomechanics, and systematic area of study. physiology. Pre-requisite: BI 235 and BI 236. PE 259 Adapted Physical Education, Recreation and Sport (2) PE 356 Kinesiology and Biomechanics (3) The study of challenged youngsters, identifying the 7KHFRXUVHLVGHVLJQHGWRLQYHVWLJDWHIRXUFRPSRQHQWVRISK\VLFDO FKDUDFWHULVWLFVRIYDULRXVJURXSVDQGWKHFKDOOHQJHVRIPHHWLQJ DFWLYLW\ D ORFDWLRQRULJLQLQVHUWLRQDQGDFWLRQRIWKHPDMRU WKHLUQHHGVWKURXJKWKHVHOHFWLRQRIWKHDSSURSULDWHDFWLYLWLHV PXVFOHVLQYROYHGLQSK\VLFDODFWLYLW\ E SULQFLSOHVRIPRWLRQ Course Descriptions 79 DQGKRZWKH\DSSO\LQWKHSK\VLFDOHGXFDWLRQVSRUWGRPDLQ F DQDO\VLVRIYDULRXVDVSHFWVRIKXPDQPRYHPHQWIRUHI¿FLHQF\ PE 481 Organization and Administration of Health, Physical DQGHIIHFWLYHQHVV G LPSURYHPHQWRIPRYHPHQWVW\OHEDVHGRQ Education, and Sport (3) DSSOLFDWLRQRISK\VLFVSULQFLSOHVWRDQDO\VLVRIPRYHPHQW3UH Organization and administration of health, physical education, UHTXLVLWH 3( %,DQG%, sports medicine, and wellness programs with an emphasis on facilities, equipment, budget, scheduling, community PE 358 Motor Learning and Movement Education (3) relationships, use of community resources, current issues, (PSKDVLVRQPRYHPHQWDQGPRYHPHQWEHKDYLRUDVDEDVLVIRU DQGHWKLFDOFRQFHUQV$IWHUWKH¿UVW¿YHZHHNVWKHFRXUVH OHDUQLQJ'HYHORSDQXQGHUVWDQGLQJRIWKHIDFWRUVWKDWDIIHFW ZLOOLQYROYHWHDPWHDFKLQJ6WXGHQWVZLOOEHSODFHGLQJURXSV motor learning, performance, and retention through the study of DFFRUGLQJWRWKHLUPDMRUDUHDRIVWXG\2SHQWRMXQLRUVDQG VNLOODFTXLVLWLRQSUDFWLFHVHWWLQJVW\SHVRIIHHGEDFNSRVLWLYHDQG seniors only. bilateral transfer, speed and reaction time. Library research is required with each assigned laboratory. Pre-requisite: PE 256. PE 491 Internship (3) 7KLVLQWHUQVKLSLVGHVLJQHGIRUDQ\VWXGHQWZKRGRHVQ WGHVLUHWR PE 361 Principles of Coaching (2) take the Physical Education licensure track. Each student will 7KHFRXUVHZLOOSURYLGHVWXGHQWVZLWKLQIRUPDWLRQUHODWLYHWR be placed in an off campus learning experience related to their coaching that concerns training, conditioning, communication, ¿HOGIRUDQHQWLUHVHPHVWHU(DFKLQWHUQVKLSZLOOFXOPLQDWHZLWK PRWLYDWLRQHWKLFVDQGRUJDQL]DWLRQ7KHFRXUVHLVUHTXLUHG DVXFFHVVIXORUDOSUHVHQWDWLRQ FDSVWRQHH[SHULHQFH WRWKHIDFXOW\ before the student schedules one of the following: PE 362 or the Sport Science Department. through PE 367. Offered in fall of odd alternate years. Physics PE 362 Methods in Coaching Track (1) PH 100 Physical Science 0HWKRGVDQGWHFKQLTXHVIRUFRDFKLQJWKHYDULRXVWUDFNDQG¿HOG $QH[SORUDWLRQRIWKHSK\VLFDOXQLYHUVH SK\VLFVFKHPLVWU\DQG HYHQWV3UDFWLFHRUJDQL]DWLRQDQGDGPLQLVWUDWLRQLVVWUHVVHGZLWK DVWURQRP\ ZLWKWKHSXUSRVHRIKHOSLQJWKHVWXGHQWGHYHORS VSHFL¿FVWUDWHJLHVDQGFRQGLWLRQLQJ3UHUHTXLVLWH 3( an understanding and appreciation of physical phenomena. Mathematics used includes arithmetic and elementary algebra. PE 363 Methods in Coaching Basketball (1) Three class periods and one laboratory period per week. Methods and techniques for coaching basketball. Practice organization and administration is stressed, along with the PH 195 Physical Science Concepts (4) VSHFL¿FVWUDWHJLHVDQGFRQGLWLRQLQJ3UHUHTXLVLWH 3( 7KLVFODVVDOORZVIRUWKHH[SORUDWLRQRIWKHGHYHORSPHQW RIPRGHUQVFLHQWL¿FWKRXJKWVSHFL¿FDOO\WKHGHYHORSPHQW PE 364 Methods in Coaching Softball (1) of physical science concepts. This students will gain an Methods and techniques for coaching softball. Practice DSSUHFLDWLRQRIKRZWKHVFLHQWL¿FPHWKRGIDFLOLWDWHVDQ organization and administration is stressed, along with the XQGHUVWDQGLQJRIWKHSK\VLFDOXQLYHUVHWKURXJKREVHUYDWLRQ VSHFL¿FVWUDWHJLHVDQGFRQGLWLRQLQJ3UHUHTXLVLWH 3( LQYHVWLJDWLRQDQGLQIHUHQFH7KHVWXGHQWVZLOOH[SORUHWKH SK\VLFDOPHFKDQLVPVRIWKHXQLYHUVHDQGWKHV\QHUJLVWLFOLQNV PE 365 Methods in Coaching Baseball (1) between these processes, the human culture. Methods and techniques for coaching baseball. Practice organization and administration is stressed, along with the PH 202 Introduction to Geology (4) VSHFL¿FVWUDWHJLHVDQGFRQGLWLRQLQJ3UHUHTXLVLWH 3( This course explores the relationships between human beings and WKHLUJHRORJLFDOHQYLURQPHQW7KHHDUWKLVYLHZHGDVDG\QDPLF PE 366 Methods in Coaching Football (1) SODQHWDIIHFWHGE\VXGGHQYLROHQWHYHQWVVXFKDVYROFDQLF Methods and techniques for coaching football. Practice HUXSWLRQVHDUWKTXDNHVDQGÀRRGVDVZHOODVE\VORZHUSURFHVVHV organization and administration is stressed, along with the RSHUDWLQJRYHUORQJWLPHVSDQVWKDWFUHDWHPRYHDQGGHVWUR\ VSHFL¿FVWUDWHJLHVDQGFRQGLWLRQLQJ3UHUHTXLVLWH 3( FRQWLQHQWVDQGRFHDQV7RSLFVZLOOLQFOXGH JHRORJLFDOKD]DUGV VXFKDVHDUWKTXDNHVYROFDQRHVDQGÀRRGLQJ VRLOZDWHUDQG PE 367 Methods in Coaching Volleyball (1) DLUSROOXWLRQDQG WKHIRUPDWLRQRIPLQHUDOVURFNVVRLOIRVVLO 0HWKRGVDQGWHFKQLTXHVIRUFRDFKLQJYROOH\EDOO3UDFWLFH fuels, and other natural resources. organization and administration is stressed, along with the VSHFL¿FVWUDWHJLHVDQGFRQGLWLRQLQJ3UHUHTXLVLWH 3( PH 210 General Physics , PE 372 Recreation Programming (3) ,QWURGXFWRU\FRXUVHLQSK\VLFVFRYHULQJWKHWRSLFVRIPHFKDQLFV sound and heat. Three class periods and one laboratory period per ,GHQWLI\DQGGHVLJQDYDULHW\RIUHFUHDWLRQDODFWLYLWLHVVXLWDEOHIRU week. Prerequisite: MA 106 or permission of instructor. YDULRXVUHFUHDWLRQDOVHWWLQJV%HFRPHDZDUHRIRUJDQL]DWLRQDO VWUDWHJLHVVXLWDEOHIRUWKHVHDFWLYLWLHVLQWKHLUVSHFL¿FVHWWLQJV Course Descriptions 80 PH 220 General Physics II PY 227 Adolescence and Adulthood (3) ,QWURGXFWRU\FRXUVHLQSK\VLFVFRYHULQJWKHWRSLFVRIHOHFWULFLW\ 7KHFRXUVHFRYHUVELRSV\FKRVRFLDOLVVXHVRIGHYHORSPHQWRIWKH magnetism, optics, atomic and nuclear physics. Three class KXPDQEHLQJIURPSXEHUW\WKURXJKDGYDQFHGDJH.H\WUDQVLWLRQV periods and one laboratory period per week. Prerequisite: PH 210 in the family, interpersonal, educational and occupational realms or permission of instructor. of life are highlighted. Prerequisite: PY 110. PY 230 Behavioral Statistics Political Science 4XDQWLWDWLYHDQDO\VLVRIEHKDYLRUDOPHDVXUHVLQFOXGLQJ PS 121 American National Government GHVFULSWLYHFRUUHODWLRQDODQGLQIHUHQWLDOPHWKRGV5HSRUW An introduction to the nature, scope, and roles of American ZULWLQJLQWKHEHKDYLRUDOVFLHQFHVLVDOVRHPSKDVL]HG QDWLRQDOJRYHUQPHQWDQGSROLWLFVLQKLVWRULFDODQGFRQWHPSRUDU\ Knowledge of basic algebra is recommended. contexts. PY 290 Abnormal Psychology PS 122 American State and Local Government $QH[DPLQDWLRQRIWKHVLJQVDQGV\PSWRPVRIEHKDYLRUDO $QLQWURGXFWLRQWR$PHULFDQVWDWHDQGORFDOJRYHUQPHQWVLQ pathology and the interplay of social, learning, and physiological WHUPVRIWKHLUKLVWRULFDOGHYHORSPHQWLQWHUUHODWLRQVKLSVSRZHUV factors in the etiology of mental disorders. Prerequisite: PY 110. DQGIXQFWLRQVDQGLVVXHVIDFLQJWKHP6LJQL¿FDQWDWWHQWLRQWR JRYHUQDQFHLQPHWURSROLWDQDUHDV PY 301 Research Methods An introduction to the principles and methods of organizing, PS 224 Public Opinion and Propaganda FRQGXFWLQJDQGLQWHUSUHWLQJEHKDYLRUDODQGVRFLDOUHVHDUFK Formation of public opinion in a democracy and its role. ([DPLQDWLRQRIVXUYH\H[SHULPHQWDOVLQJOHFDVHGHVLJQ Analysis of mass communication and the uses of propaganda HYDOXDWLRQDQGREVHUYDWLRQDOWHFKQLTXHVDVZHOODVLVVXHVRI in democratic and non-democratic states. Focus will be on measurement are addressed. Prerequisite: PY 230. intention, message and effects of uses of propaganda. Offered in odd alternate years. PY 302 Experimental Psychology $ODERUDWRU\FRXUVHFRQFHUQLQJYDULRXVH[SHULPHQWDODUHDVRI PS 336 History of the Constitution (3) psychology: research design, methodology, and report writing. 7KHEDFNJURXQGRIRXUFRQVWLWXWLRQDOGHYHORSPHQWIURPQDWXUDO 7KHVWXGHQWZLOOSODQDQGFRQGXFWDQH[SHULPHQW UHVHDUFK law to the present. Offered in odd alternate years. SURMHFW XQGHUWKHGLUHFWLRQRIDIDFXOW\PHPEHU3UHUHTXLVLWHV 3<RUHTXLYDOHQW3<RUHTXLYDOHQWDQGFRQVHQWRIWKH PS 371 Constitutional Law instructor. $VWXG\RIWKH86FRQVWLWXWLRQWKURXJKDQDO\VLVRIPDMRU Supreme Court decisions and the impact of those decisions upon PY 310 Social Psychology the American political process. Prerequisite: PS 121. Offered in $QDQDO\VLVRILQGLYLGXDOJURXSDQGFROOHFWLYHEHKDYLRUIURP HYHQDOWHUQDWH\HDUV ERWKSV\FKRORJLFDOSHUVSHFWLYHV7RSLFVLQFOXGHJHQHUDOWKHRULHV methods and empirical data on attribution, social perception, PS 495 Special Topics may be taken in political science. See DWWLWXGHIRUPDWLRQDQGFRQIRUPLW\3UHUHTXLVLWH 3< QRW descriptions of these courses under the Criminal Justice section. RSHQWRIUHVKPHQ Psychology PY 315 Theories of Personality PY 110 Introduction to Psychology $FRPSDUDWLYHVWXG\RIFODVVLFDODQGUHFHQWWKHRULHVRIQRUPDO The application of psychological principles to the understanding SHUVRQDOLW\VWUXFWXUHVDQGGHYHORSPHQWZLWKDQH[DPLQDWLRQ RIKXPDQEHKDYLRU QRWRSHQWRFRQGLWLRQDOO\DFFHSWHG¿UVW RIWKHVXSSRUWLQJUHVHDUFK3UHUHTXLVLWH 3< QRWRSHQWR VHPHVWHUIUHVKPHQ IUHVKPHQ PY 190 History and Systems in Psychology PY 320 Psychological Tests and Measurements $UHYLHZRIPDMRUKLVWRULFDODQGWKHRUHWLFDOSHUVSHFWLYHVLQ $QHYDOXDWLRQRIWKHRUHWLFDODQGSUDFWLFDOLVVXHVLQWKH SV\FKRORJ\,PSRUWDQW¿JXUHVLQWKHKLVWRU\RISV\FKRORJ\DVD PHDVXUHPHQWRILQWHOOLJHQFHSHUVRQDOLW\DQGDYRFDWLRQIRU science and as a profession will be considered. Prerequisite: PY UHVSHFWLYHXVHLQVFKRROFOLQLFDODQGLQGXVWULDOVHWWLQJV 110. Topics include the construction, analysis, administration, and presentation of standardized tests, as well as issues in PY 225 Infancy and Childhood LQWHUSUHWDWLRQRIWHVWVFRUHVDQGEHKDYLRU3UHUHTXLVLWH 3< $QLQWURGXFWLRQWRQRUPDWLYHSK\VLRORJLFDOVRFLDOFRJQLWLYHDQG DQGEDVLFDOJHEUDRUDQ\VWDWLVWLFVFRXUVH QRWRSHQWRIUHVKPHQ HPRWLRQDOGHYHORSPHQWDVDFRQWLQXRXVSURFHVVIURPFRQFHSWLRQ Offered in alternate years. through late childhood. Prerequisite: PY 110. PY 430 Memory and Cognition (3) Course Descriptions 81 The course explores the information processing approach to applying these foundations. Building upon the foundations and memory and thinking. Topics include memory processes, concept LQWHUUHODWLQJWKHPZLWKSUHYLRXVO\DFTXLUHGXQGHUVWDQGLQJ IRUPDWLRQDQGUHDVRQLQJ3UHUHTXLVLWH 3<DQGMXQLRUVHQLRU DQGNQRZOHGJHVWXGHQWVZLOOGHYHORSDVWDWHPHQWVHWWLQJIRUWK standing. WKHLUSKLORVRSK\RI&KULVWLDQUHOLJLRXVHGXFDWLRQWKDWZLOOVHUYH as a guideline for educational strategy, methods, curriculum, PY 450 Psychobiology UHODWLRQVKLSVDQGHYDOXDWLRQLQWKHVWXGHQW¶VSURIHVVLRQDOFRQWH[W An examination of the biological and physiological basis of Offered in alternate years. EHKDYLRUDQGGHYHORSPHQWZLWKVSHFLDOHPSKDVLVRQWKHQHXUDO substrates. Prerequisite: PY 110, 4 hours of Natural Science and RL 175 Effective Involvement of the Laity (3) MXQLRUVHQLRUVWDQGLQJ2IIHUHGLQDOWHUQDWH\HDUV One of the most critical issues in religious education is that RILQYROYLQJYROXQWHHUOD\SHUVRQVDVWHDFKHUVOHDGHUVDQG PY 195, 395 Special Topics administrators within the church. Theoretical and practical $GYDQFHGWRSLFVRIDVSHFL¿FDQGQDUURZEXWWLPHO\QDWXUH HOHPHQWVHVVHQWLDOWRHIIHFWLYHLQYROYHPHQWRIODLW\DUHLGHQWL¿HG DQGLQYROYLQJDIDFXOW\PHPEHU¶VDUHDRIH[SHUWLVHVHOHFWHGIRU &HQWUDOWRWKHVWXG\DUHELEOLFDOYVVHFXODUFRQFHSWVRIODLW\DQG H[DPLQDWLRQDQGGLVFXVVLRQ3UHUHTXLVLWH 3< QRWRSHQWR the potential contributions of laity within the congregation and IUHVKPHQ 2IIHUHGRQGHPDQG0D\EHUHSHDWHG society at large. Offered in alternate years. PY 497 Field Experience RL 191 Service Learning: Church Life and Leadership 7KHVWXGHQWLVDVVLJQHGWRRQHRIVHYHUDODUHDDJHQFLHVWRJDLQ 6WXGHQWVSURYLGHKRXUVRIYROXQWDU\VHUYLFHOHDGHUVKLSIRU REVHUYDWLRQDOH[SHULHQFHDQGWRGHYHORSSURIHVVLRQDOEHKDYLRU DUHOLJLRXVFRPPXQLW\RUUHOLJLRXVVHUYLFHRUJDQL]DWLRQSOXV Prerequisite: 15 hours of psychology. Offered on demand. DQHTXLYDOHQWRUJUHDWHUDPRXQWRIWLPHLQSUHSDUDWLRQDQG UHÀHFWLRQ$QLQGLYLGXDOSODQLQFOXGLQJJXLGHGSDUWLFLSDWLRQ PY 498 Senior Seminar LQUHJXODUDFWLYLWLHVRIWKHRUJDQL]DWLRQDVSHFLDOSURMHFWDQG A senior capstone course oriented toward the professional DSSURSULDWHUHDGLQJVDQGUHÀHFWLRQVLQZULWLQJDUHLQFOXGHGHDFK GHYHORSPHQWRIWKHVWXGHQWWKURXJKFRQWULEXWLRQVRIGLVFXVVLRQ semester. This course may be taken up to three semesters for a and exploration in contemporary areas of psychology. A research maximum of three credit hours. SURMHFWLVUHTXLUHG3UHUHTXLVLWH VHQLRUVWDQGLQJZLWKDPDMRURU minor in psychology. RL 198 Seminar in Religious Studies (1/2) 2IIHUHGHVSHFLDOO\IRUVWXGHQWVPDMRULQJLQUHOLJLRXVVWXGLHV PY 499 Advanced Independent Research Christian Education and pre-seminary students, the seminar is $QLQGLYLGXDOL]HGQRQFODVVURRPFRXUVHWKDWLQYROYHVDQ open to any interested student. Topics encourage the exploration LQGHSHQGHQWUHVHDUFKGHVLJQGLUHFWHGWRZDUGVRPHVSHFL¿F RISHUVRQDOIDLWKDQGLWVLPSOLFDWLRQVLQFOXGLQJJURXSDQG¿HOG hypothesis. The student must submit application and proposal EDVHGVHUYLFHDQGOHDGHUVKLSH[SHULHQFHV&RQYHUVDWLRQVSURPRWH WKURXJKDIDFXOW\VXSHUYLVRU3UHUHTXLVLWH 3<DQG HFXPHQLFDOXQGHUVWDQGLQJDQGVKDUHGUHÀHFWLRQIRUVWXGHQWV Offered on demand. May be repeated. and faculty alike. This course may be taken up to six semesters IRUDPD[LPXPRIWKUHHFUHGLWKRXUV0DMRURUPLQRUVWDWXVRU Religion and Christian Education permission of instructor required. RL 110 Spirituality and Wholeness (2) This course explores approaches to greater spiritual wholeness RL 201 Approaches to Religion IRUOLYHVWKDWRIWHQVHHPIUDJPHQWHG5HDGLQJVDQGGLVFXVVLRQV $VWXG\RIWKHQDWXUHRIUHOLJLRXVLGHDVYDOXHVDQGH[SHULHQFHV may include such topics as: spiritual and physical disciplines of focusing on Hinduism, Buddhism, Confucianism, Taoism, Judaism, Christianity, and Islam. Insights about religion gained PHGLWDWLRQDQGSUD\HU KROLVWLFPRUDOGHFLVLRQPDNLQJ QDWXUDO from psychology, anthropology, and philosophy will also be DQGUHOLJLRXVGLPHQVLRQVRIKHDOLQJ FRPPXQLW\LQWHJULW\WKURXJK examined. Prerequisite: EN111, AH 111, AH 112 or Permission VHUYLFHWRRWKHUV DQGDQHYDOXDWLRQRIUHOLJLRXVEHOLHIVDERXWGLHW and exercise. Offered in alternate years. of Instructor. RL 122 Foundations of Religious Education (3) RL 211 Introduction to the Hebrew Bible (3) Through the rich literature of the Hebrew Bible and the history 7KLVFRXUVHRIIHUVDVXUYH\RIVL[IRXQGDWLRQDOHOHPHQWVRI of ancient Israel, students will be introduced to some of the UHOLJLRXVHGXFDWLRQ ELEOLFDOWKHRORJLFDOSV\FKRORJLFDO VRFLRORJLFDOOHJDODQGKLVWRULFDO WKDWVHUYHDVWKHEDVLVIRUD IRXQGDWLRQDOEHOLHIVYDOXHVDQGSUDFWLFHVRI:HVWHUQFXOWXUDO philosophy and practice of Christian religious education. Students heritage. The course acquaints students with critical literary and historical methods of understanding the Bible in its context as ZLOOVWXG\DQGLQYDULRXVVHWWLQJVRIHQJDJHPHQWSUDFWLFH Course Descriptions 82 well as its meaning for people of faith today. Prerequisite: EN111, QHHGVLQYDULHGVLWXDWLRQVLQFOXGLQJLQWUDDQGLQWHUJURXS AH111, AH112 or permission of instructor. FRQÀLFW0HWKRGRORJ\LQYROYHVDVHULHVRIH[HUFLVHVZLWKJURXSV LQFOXGLQJWKHXVHRIYLGHRWDSHGUHFRUGLQJVDQGUHFHLYLQJDQG RL 212 Teachings of Jesus and Life of the Early Church JLYLQJIHHGEDFN2IIHUHGLQDOWHUQDWH\HDUV Through the Gospels, the letters of Paul, and other New Testament writings students will explore the world of Jesus RL 356 Forming One’s Faith and his compelling message. The course introduces critical A study of the nature of religious faith from a Christian PHWKRGVIRUXQGHUVWDQGLQJWKHGLVWLQFWLYHWKHPHVRIWKH*RVSHOV SHUVSHFWLYH&RPSRQHQWVRIWKHFRXUVHLQFOXGH UHDGLQJVLQ DQGLQYLWHVSRVVLEOHZD\VIRUSHRSOHRIIDLWKWRGD\WRJUDVSWKH &KULVWLDQWKHRORJ\ VWXG\RIJUHDWUHOLJLRXVOHDGHUV DQGDQ meaning of Jesus’ message and ministry. Prerequisite: RL 211 or LQYHVWLJDWLRQRIVSHFL¿FUHOLJLRXVLVVXHVFKRVHQE\WKHVWXGHQW permission of instructor. 'HVLJQHGIRUMXQLRUDQGVHQLRUVWXGHQWVPDMRULQJRUPLQRULQJLQ religion. Offered in alternate years. RL 250 Curriculum and Resources (3) This course examines curriculum theory and practice from RL 360 Women and Men through the History of Christianity philosophical, theological, historical, and methodological (3) SHUVSHFWLYHV7KHFRXUVHHTXLSVVWXGHQWVZLWKWRROVDQG Important themes in the history of Christian faith and practice WHFKQLTXHVWRREVHUYHDQGHYDOXDWHFXUULFXODDQGWRDVVHVV are traced from Jesus and the early church to the 21st century. OHDUQLQJHQYLURQPHQWV LQFOXGLQJWKHUHDOLW\RILPSOLFLWDQGQXOO 6WXGHQWVZLOOH[SORUHOLYHVRIRXWVWDQGLQJZRPHQDQGPHQZKR FXUULFXOD DQGKRZWKRVHOHDUQLQJHQYLURQPHQWVLQWHUDFWZLWK KDYHPDGHVLJQL¿FDQWFRQWULEXWLRQVWR&KULVWLDQOLIH3DUWLFXODU written curricula. Students are required to apply concepts from DWWHQWLRQZLOOEHJLYHQWRWKHVKLIWLQJOHDGHUVKLSUROHVRIZRPHQ WKLVFRXUVHLQFRQVWUXFWLQJDQHYDOXDWLRQWRROWKDWWKHVWXGHQWZLOO and men in church history. Offered in alternate years. XVHLQWKH¿HOGLQWKHFRPSOHWLRQRIFRXUVHUHTXLUHPHQWV2IIHUHG in alternate years. RL 395 Special Topics At least one course will be offered in alternate years in order to RL 265 The Black Church in America meet the interests of students on timely issues about religious This course will examine the historical role of the Black Church studies. Course titles may include: IURPDQWHEHOOXPVODYHU\WRWKHSUHVHQWGD\&RQVLGHUDWLRQZLOOEH American Religious Experience JLYHQWRWKHKLVWRU\RI%ODFNUHOLJLRXVGHQRPLQDWLRQVDQGWKHLU Christian Ethics contribution to the uplift of the Black race. This course will also Death and Dying examine the ecology of the Black Church, the spiritualities of Philosophy of Religion the Black Church, and the social witness of the Black Church. Principles of Biblical Interpretation Prominent leaders whose roots lie in the Black Church will be Women and Religion GLVFXVVHG)LQDOO\FRQVLGHUDWLRQZLOOEHJLYHQWRWKHYDULRXV PRGHOVWKDW¿QGH[SUHVVLRQLQWKH%ODFN&KXUFK $VVLPLODWLRQ RL 397 Field Experience 0RGHO ,VRODWLRQ0RGHO &RPSHQVDWRU\0RGHO DQG $MXQLRUOHYHO¿HOGSODFHPHQWIRUVWXGHQWVPDMRULQJLQ&KULVWLDQ Ethnic-Community Prophetic Model. education. RL 321 Ethics and Morals (3) RL 475 Administrative Policies and Practices (3) $VXUYH\RISKLORVRSKLFDODQGWKHRORJLFDOUHVRXUFHVDYDLODEOH Thoughtful leadership, teaching skills, printed resources, for the consideration of ethical questions, combined with case DGHTXDWH¿QDQFHVDQGLQVWLWXWLRQDOUHODWLRQVKLSVDUHFULWLFDOWR studies drawn from current moral issues and dilemmas. Students the success of any educational program. In this course students FDQIRFXVRQHWKLFDOLVVXHVLQWKHLUPDMRU¿HOGVLQWKHFRQWH[WRID ZLOOEHLQWURGXFHGWRLVVXHVLQOHDGHUVKLSWKHRU\PRWLYDWLRQ research assignment. human resources, planning and budgeting, institutional structures, DQGLQVWLWXWLRQDOUHODWLRQVKLSV6WXGHQWVZLOOGHYHORSWKHLURZQ RL 338 Religions of the East theoretical approach to each of these issues through reading, $QDGYDQFHGVWXG\RIVFULSWXUHVDQGLQQHUZRUNLQJVRIUHOLJLRQV FODVVGLVFXVVLRQZULWWHQUHÀHFWLRQDQG¿HOGEDVHGSUDFWLFDO of the Far East and Middle East including Hinduism, Buddhism, DSSOLFDWLRQ7REHWDNHQFRQFXUUHQWO\ZLWKMXQLRURUVHQLRUOHYHO Confucianism, Taoism, Shinto, and Islam. Prerequisite: RL 201 ¿HOGZRUN2IIHUHGLQDOWHUQDWH\HDUV or permission of instructor. Offered in alternate years. RL 497 Field Experience (3+3) RL 353 Leadership and Group Work Theory (3) $VHQLRUOHYHO¿HOGSODFHPHQWIRUVWXGHQWVPDMRULQJLQ&KULVWLDQ A balance of research techniques and experiential approaches HGXFDWLRQ&KULVWLDQ(GXFDWLRQPDMRUVFRPSOHWHWKHLUFDSVWRQHDV is employed in this course to enable students to gain social- part of this sequence. psychological and theological understanding of leadership styles DQGWKHLUHIIHFWVDVZHOODVJURXSSURFHVVHV6NLOOVDUHGHYHORSHG LQLGHQWLI\LQJGLDJQRVLQJDQGDFWLQJXSRQJURXSDQGLQGLYLGXDO Course Descriptions 83 RL 499 Senior Capstone PHPEHUDQGDTXDOL¿HGSHUVRQLQWKH¿HOGZKHUHWKHVWXGHQWLV 5HOLJLRQ6WXGLHVPDMRUVFKRRVHDQLQGHSHQGHQWSURMHFWUHODWHG working. Each internship will culminate with a successful oral WRWKHLUFRXUVHZRUNLQWKHPDMRU7KHFDSVWRQHLQWHJUDWHVWKH SUHVHQWDWLRQ FDSVWRQHH[SHULHQFH WRWKHIDFXOW\RIWKH6SRUW students’ learning in religious studies and/or related disciplines Science Department. with practical experience or with specialized research. A presentation of the results of student work is required and a SM 247, 397 Field Experience FRPSRQHQWRIFRPPXQLW\VHUYLFHLVVWURQJO\HQFRXUDJHG Field experience affords students an opportunity to engage in QRQFODVVURRPOHDUQLQJXQGHUWKHVXSHUYLVLRQRIDTXDOL¿HG person. The program is designed to introduce students to a professional area before enrolling in professional courses and to enable the student who has completed some professional courses to apply the principles and techniques acquired to a practical situation. Students are expected to analyze critically the situation Sport Management DQGWRHYDOXDWHWKHH[SHULHQFHLQOLJKWRIWKHLUFRXUVHZRUNDQG SM 130 Sport Management career plans. Students must make arrangements with a faculty Introduces the theoretical foundations and applied areas of sports VXSHUYLVRUSULRUWRHQUROOLQJ PDQDJHPHQW7KHFRXUVHLVGHVLJQHGIRUWKHLQGLYLGXDOLQWHUHVWHG LQSXUVXLQJDFDUHHULQWKHVSRUWPDQDJHPHQW¿HOG2IIHUHGLQWKH VSULQJRIHYHQDOWHUQDWH\HDUV Sociology SO 120 Life in Society SM 270 History of Sports in the United States Designed as an introductory course in the social sciences for the 7KLVFRXUVHZLOOH[DPLQHWKHGHYHORSPHQWDQGPRGHUQL]DWLRQ JHQHUDOVWXGHQWDVZHOODVSUHSDULQJVRFLDOVFLHQFHPDMRUVIRU of sports in the United States from colonial times to the present DGYDQFHGZRUNLQWKHLUUHVSHFWLYHPDMRUVWKLVFRXUVHFRQWHQW DQGWKHVRFLRFXOWXUDOIDFWRUVZKLFKKDYHDIIHFWHGWKHLUJURZWK ZLOOH[DPLQHWKHGLYHUVLW\RIKXPDQVRFLHWLHVE\XQGHUVWDQGLQJ 2IIHUHGLQVSULQJRIHYHQDOWHUQDWH\HDUV the nature of culture and its impact on social life. Variation in the structure and dynamics of organizations, communities, and SM 320 Sociology of Sport VRFLHWLHVZLOODOVREHDGGUHVVHGLQWKHFRXUVH$GGLWLRQDOO\PDMRU &RQWHPSRUDU\VSRUWIURPDVRFLRORJLFDOSHUVSHFWLYH7RSLFV WKHRUHWLFDOSHUVSHFWLYHVIURPWKHVRFLDOVFLHQFHGLVFLSOLQHVZLOO will include the discussion of the relationship of sport to EHLQWURGXFHGDVZHOODVVXEVWDQWLDODWWHQWLRQJLYHQWRLVVXHVRI VRFLDOLQVWLWXWLRQVWKHLQGLYLGXDO VVRFLDOL]DWLRQLQWRVSRUWDQG globalization and cross-cultural comparisons. VWUDWL¿FDWLRQIDFWRUVZLWKLQVSRUWV2IIHUHGLQVSULQJRIRGG alternate years. SO 235 Social Problems (3) The purpose of this course is to facilitate increased awareness SM 330 Advanced Sport Management and understanding of social problems in the United States The students will gain a greater understanding of special interet and throughout the world. Sociological theories, research and and topics in areas of Sport Management. Outside assignments PRYHPHQWVZLOOEHDGGUHVVHGLQUHFRJQL]LQJVRFLDOSUREOHPVDQG ZLOOSODFHVWXGHQWVLQVSRUWPDQDJHPHQWVHWWLQJVWRREVHUYH generating possible strategies for action. Problems of well being, practices and procedures. Prerequisite: SM 130 or permission of KXPDQGLYHUVLW\LQHTXDOLW\DQGPRGHUQL]DWLRQZLOOEHH[DPLQHG LQVWUXFWRU2IIHUHGLQWKHVSULQJRIHYHQDOWHUQDWH\HDUV 7KHFRXUVHZLOOHQFRXUDJHYDOXHFODUL¿FDWLRQDQGFULWLFDOWKLQNLQJ LQUHVROYLQJFXUUHQWVRFLDOSUREOHPV3UHUHTXLVLWH 6:DQG SM 481 Organization and Administration of Health, Physical PY 110. Education, and Sport (3) Organization and administration of health, physical education, SO 239 Marriage and Family Life sport management, athletic training, and wellness programming A functional course which deals with relationships from dating will be addressed with an emphasis on facility planning, through the marital life cycle. It focuses on the dynamics of equipment procurement, budgeting, program scheduling, IDPLO\LQWHUDFWLRQVDQGFRPPXQLFDWLRQVDVZHOODVYDULRXV community relationships, current issues, and legal and ethical V\VWHPVWRDQDO\]HIDPLOLHVDQGWRLQWHUYHQHLQIDPLO\ FRQFHUQV$IWHUWKHLQLWLDOFRUH¿YHZHHNVRILQVWUXFWLRQWKH dysfunctioning. course will be team taught to allow students to specialize within WKHLUPDMRUDUHDRIVWXG\2SHQWRMXQLRUVDQGVHQLRUVRQO\ SO 265 Cultural Diversity (3) The goal of the course is to expand one’s knowledge and SM 491 Internship XQGHUVWDQGLQJRIOLYLQJZRUNLQJDQGUHODWLQJLQDFXOWXUDOO\ $QRQWKHMREOHDUQLQJH[SHULHQFHUHODWHGWRWKH¿HOGRIVWXG\ GLYHUVHVRFLHW\'LYHUVLW\ZLOOEHH[DPLQHGRQORFDOQDWLRQDODQG $QLQWHUQVKLSLVFRRSHUDWLYHO\VXSHUYLVHGE\DFROOHJHIDFXOW\ global fronts including the forms and mechanisms of oppression Course Descriptions 84 DQGGLVFULPLQDWLRQDVZHOODVVWUDWHJLHVIRUFKDQJHWKDWDGYDQFH Designed as an introductory course in the social sciences for the VRFLDODQGHFRQRPLFMXVWLFH,VVXHVVXFKDVHWKQLFLW\UDFH JHQHUDOVWXGHQWDVZHOODVSUHSDULQJVRFLDOVFLHQFHPDMRUVIRU religion, gender, sexual orientation, age, mental/physic ability, DGYDQFHGZRUNLQWKHLUUHVSHFWLYHPDMRUVWKLVFRXUVHFRQWHQW and social class will be explored. ZLOOH[DPLQHWKHGLYHUVLW\RIKXPDQVRFLHWLHVE\XQGHUVWDQGLQJ the nature of culture and its impact on social life. Variation in SO 270 Sociological History of Sports in the United States the structure and dynamics of organizations, communities, and 7KLVFRXUVHZLOOH[DPLQHWKHGHYHORSPHQWDQGPRGHUQL]DWLRQRI VRFLHWLHVZLOODOVREHDGGUHVVHGLQWKHFRXUVH$GGLWLRQDOO\PDMRU sports in the United States from colonial times to the present and WKHRUHWLFDOSHUVSHFWLYHVIURPWKHVRFLDOVFLHQFHGLVFLSOLQHVZLOO WKHVRFLRFXOWXUDOIDFWRUVZKLFKKDYHDIIHFWHGWKHLUJURZWK EHLQWURGXFHGDVZHOODVVXEVWDQWLDODWWHQWLRQJLYHQWRLVVXHVRI globalization and cross-cultural comparisons. SO 310 Social Psychology $QDQDO\VLVRILQGLYLGXDOJURXSDQGFROOHFWLYHEHKDYLRUIURP SW 121 Introduction to Social Work ERWKSV\FKRORJLFDOSHUVSHFWLYHV7RSLFVLQFOXGHJHQHUDOWKHRULHV An introduction to the understanding of the concept of the social methods, and empirical data on attribution, social perception, at- ZRUNSURIHVVLRQLWVVLJQL¿FDQFHLQVRFLHW\LWVKLVWRU\DQGLWV WLWXGHIRUPDWLRQDQGFRQIRUPLW\3UHUHTXLVLWH 3< QRWRSHQ SODFHDPRQJWKHKHOSLQJSURIHVVLRQV7KHVWXG\RIWKHJRDOVYDO- WRIUHVKPHQ ues, knowledge base, methods, and settings of social work. The beginning of the professionalization process. SO 320 Sociology of Sport &RQWHPSRUDU\VSRUWIURPDVRFLRORJLFDOSHUVSHFWLYH7RSLFVZLOO SW 230 Behavioral Statistics include the discussion of the relationship of sport to social institu- 4XDQWLWDWLYHDQDO\VLVRIEHKDYLRUDOPHDVXUHVLQFOXGLQJGHVFULS- WLRQVWKHLQGLYLGXDO¶VVRFLDOL]DWLRQLQWRVSRUWDQGVWUDWL¿FDWLRQ WLYHFRUUHODWLRQDODQGLQIHUHQWLDOPHWKRGV5HSRUWZULWLQJLQWKH factors within sports. Offered in spring of odd alternate years. EHKDYLRUDOVFLHQFHVLVDGGLWLRQDOO\HPSKDVL]HG.QRZOHGJHRI basic algebra is recommended. SO 361 Delinquency Prevention and Control $FULWLFDOHYDOXDWLRQRIGHOLQTXHQF\FDXVDWLRQWKHRULHVDQGWKH SW 235 Social Problems (3) social structures and their interrelationship with delinquency The purpose of this course is to facilitate increased awareness SUHYHQWLRQDQGFRQWURO3UHUHTXLVLWH &-DQG62 and understanding of social problems in the United States and throughout the world. Sociological theories, research and SO 471 Criminology PRYHPHQWVZLOOEHDGGUHVVHGLQUHFRJQL]LQJVRFLDOSUREOHPVDQG An analysis of the sociocultural factors leading to crime with generating possible strategies for action. Problems of well being, an emphasis on crime causation theories and methods used to KXPDQGLYHUVLW\LQHTXDOLW\DQGPRGHUQL]DWLRQZLOOEHH[DPLQHG SUHYHQWDQGFRQWUROFULPLQDOEHKDYLRU3UHUHTXLVLWH &-DQG 7KHFRXUVHZLOOHQFRXUDJHYDOXHFODUL¿FDWLRQDQGFULWLFDOWKLQNLQJ SO 120. LQUHVROYLQJFXUUHQWVRFLDOSUREOHPV3UHUHTXLVLWH 6:DQG PY 110. SO 496 Readings Through a readings program, students may explore the literature SW 239 Marriage and Family Life RIDVSHFL¿F¿HOGLQSUHSDUDWLRQIRUDODWHULQGHSHQGHQWUHVHDUFK A functional course which deals with relationships from dating SURMHFWFDQ¿OODYRLGLQWKHLUEDFNJURXQGRUFDQUHDGWKHOLW- through the marital life cycle. It focuses on the dynamics of fam- HUDWXUHRIDVXEMHFWIRULWVRZQYDOXH,QDOOFDVHVWKHSURJUDP LO\LQWHUDFWLRQVDQGFRPPXQLFDWLRQVDVZHOODVYDULRXVV\VWHPVWR LVGLUHFWHGWRZDUGVRPHVSHFL¿FJRDORUSXUSRVH7KHVWXGHQWLV DQDO\]HIDPLOLHVDQGWRLQWHUYHQHLQIDPLO\G\VIXQFWLRQLQJ H[SHFWHGWRVXEPLWDSSOLFDWLRQWKURXJKDIDFXOW\VXSHUYLVRU SW 265 Cultural Diversity (3) The goal of the course is to expand one’s knowledge and Spanish XQGHUVWDQGLQJRIOLYLQJZRUNLQJDQGUHODWLQJLQDFXOWXUDOO\ SP 101, SP 102 Elementary Spanish I, II GLYHUVHVRFLHW\'LYHUVLW\ZLOOEHH[DPLQHGRQORFDOQDWLRQDODQG Introduction to the basic structural elements of the language global fronts including the forms and mechanisms of oppression WKURXJKRUDODXUDOGULOOVFRQWUROOHGFRQYHUVDWLRQVUHDGLQJDQG DQGGLVFULPLQDWLRQDVZHOODVVWUDWHJLHVIRUFKDQJHWKDWDGYDQFH writing. VRFLDODQGHFRQRPLFMXVWLFH,VVXHVVXFKDVHWKQLFLW\UDFH religion, gender, sexual orientation, age, mental/physic ability, Social Work and social class will be explored. SW 120 Life in Society SW 278 Interviewing and Interpersonal Communication This course examines the basic principles of oral communica- tion and their application to social work practice. The principal Course Descriptions 85 WHFKQLTXHVRILQWHUYLHZLQJLQGLYLGXDOVFRXSOHVDQGIDPLOLHVDUH communities will be discussed. Coursework will offer an explored. This is a laboratory based course with many opportuni- HPSKDVLVRQPDFUROHYHOVNLOOVZLWKLQWHJUDWLRQRIPLFURDQG WLHVIRUVNLOOGHYHORSPHQW3UHUHTXLVLWH 6:6:6: mezzo practice. Prerequisite: SW 355 and SW 356, admission to 239, and PY 110. 6RFLDO:RUN0DMRU SW 301 Research Methods SW 476 Social Welfare and Policy Development An introduction to the principles and methods of organizing, con- An examination of the programs and policies of the social wel- GXFWLQJDQGLQWHUSUHWLQJEHKDYLRUDODQGVRFLDOUHVHDUFK([DPL- fare system in the United States. It will explore the historical QDWLRQRIVXUYH\H[SHULPHQWDOVLQJOHFDVHGHVLJQHYDOXDWLRQ URRWVDQGGHYHORSPHQWVRISUHVHQWGD\SURJUDPVDQGSROLF\DV DQGREVHUYDWLRQDOWHFKQLTXHVDVZHOODVLVVXHVRIPHDVXUHPHQW well as methods and models of policy formation and analysis. are addressed. Prerequisite: PY/SW 230 is recommended. Prerequisites: SW 121, 235, 301 or permission of instructor. SW 340 Health Care Issues SW 488 Senior Seminar (3) An exploration of the roles and interactions of health care profes- 6HQLRU&DSVWRQH([SHULHQFH(PSKDVLVLVJLYHQWRLQWHJUDWLRQ sionals with an emphasis on medical social work. The course RIDOOSUHYLRXVFRXUVHFRQWHQWLQVRFLDOZRUNZLWKFRQFXUUHQW ZLOODOVRIRFXVXSRQKROLVWLFKHDOWKDQGDOWHUQDWLYHWUHDWPHQWV ¿HOGLQVWUXFWLRQ5HTXLUHVUHJXODUUHSRUWLQJRI¿HOGDFWLYLWLHV DQGDVVLVWVVWXGHQWVLQDFKLHYLQJOHDUQLQJREMHFWLYHVRIWKH¿HOG SW 345 Addictive-Compulsive Behavior SUDFWLFXP&RQVLGHUDWLRQLVJLYHQWRWKHDSSOLFDWLRQRIVRFLDO 7KLVFRXUVHVXUYH\VDZLGHDUUD\RIDGGLFWLRQVDQGFRPSXOVLRQV ZRUNWKHRU\SROLF\UHVHDUFKDQGYDOXHVWRWKH¿HOG3UHUHTXLVLWH There is a special focus on causes, treatment modalities, and the SW 355, SW 356, SW 379 and SW 397 or permission of the effects upon the family and society. Prerequisite PY 110. instructor. To be taken concurrently with SW 486. SW 355 Practice I: Generalist Practice SW 199, 299, 399, 499 An introduction to the generalist model of social work and its Independent Research may be taken in social work. See descrip- application. The course emphasizes the practice skills that are tions of these courses under the Criminal Justice section. JHQHULFWRDOOOHYHOVRISUDFWLFHZLWKLQDSUREOHPVROYLQJIUDPH RIUHIHUHQFH3UHUHTXLVLWH 6RFLDO:RUN0DMRU6:6: SW 397 Junior Field Experience (3) and the professional sequence courses. 7KHFRXUVHVHUYHVDVWKH¿UVWUHTXLUHGOHYHORI¿HOGSODFHPHQW The student is placed for 10 hours per week, or a total of 140 SW 356 Practice II: Groups and Family Generalist Practice hours within a social work setting. The student begins to utilize VRFLDOZRUNNQRZOHGJHYDOXHVDQGVNLOOVWKURXJKREVHUYDWLRQ An introduction to the understanding of group and family dynam- DQGSDUWLFLSDWLRQLQVXSHUYLVHGDFWLYLWLHVRIWKHDVVLJQHGDJHQF\ ics, group process and group treatment, and their relationship to To be taken concurrently with SW 355. Prerequisite: admission to RWKHUNLQGVRIVRFLDOZRUNLQWHUYHQWLRQ(PSKDVLVZLOOEHWKH 6RFLDO:RUN0DMRU GHYHORSPHQWPDQDJHPHQWDQGXWLOL]DWLRQRIJURXSVE\JHQHUDOLVW VRFLDOZRUNHUV3UHUHTXLVLWH 6RFLDO:RUN0DMRUDQG6: SW 486 Senior Field Instruction (9) Senior Capstone Experience. An experiential learning opportunity SW 379 Applied Behavioral Science geared toward integration of academic content with practice The purpose of this course is to integrate the required courses skills. The student is placed for 30 hours per week or a total LQWKHKXPDQEHKDYLRUDQGVRFLDOHQYLURQPHQWVHTXHQFH7KH of 450 hours. The student begins to work independently as a emphasis will be on enabling the student to see the impact of the JHQHUDOLVWVRFLDOZRUNHUXQGHUVXSHUYLVLRQZLWKLQDQDJHQF\ FOLHQW¶VJURZWKGHYHORSPHQWDQGSUHVHQWHQYLURQPHQWRQVRFLDO VHWWLQJ3UHUHTXLVLWH 6: DQG6HQLRU6RFLDO:RUN0DMRU functioning. This course will add understanding of life cycles, status. To be taken concurrently with SW 488. social systems, what constitutes healthy functioning, planned change, and theories of treatment. Prerequisite: professional sequence courses or permission of instructor. Wellness WE 390 Wellness Program Implementation SW 457 Social Work Practice III – Macro Systems Generalist 7KLVFRXUVHLVGHVLJQHGWRFRYHUWKHEDFNJURXQGDQGFXUUHQW Practice (3) practices and procedures for the implementation of wellness pro- 7KHFRXUVHLVWRSURYLGHDJHQHUDOLVWSHUVSHFWLYHWRZRUNLQJ grams in hospital, industrial, clinical, educational, and collegiate within the macro context of Social Work. Frameworks for planning and implementing change in organizations and Course Descriptions 86 VHWWLQJV2IIHUHGIDOOVHPHVWHURIHYHQ\HDUV WE 481 Organization and Adminstration of Health, Physical Education and Sport (3) Organization and administration of health, physical education, sport management, athletic training, and wellness programming will be addressed with an emphasis on facility planning, equipment procurement, budgeting, program scheduling, community relationships, current issues, and legal and ethical FRQFHUQV$IWHUWKHLQLWLDOFRUH¿YHZHHNVRILQVWUXFWLRQWKH course will be team taught to allow students to specialize within WKHLUPDMRUDUHDRIVWXG\2SHQWRMXQLRUVDQGVHQLRUVRQO\ WE 490 Wellness Program Implementation An in-depth look at current practices and procedures for the implementation of wellness programs in hospital, industrial, clinical, educational, and collegiate settings. Community assign- ments will be made, as well as hypothetical situations that will be addressed in class. A culmination of programming and manage- PHQWWHFKQLTXHVZLOOEHLPSOHPHQWHG$¿HOGVHUYLFHFRPSRQHQW is part of the course requirement. Offered fall semester in odd years. Prerequisite: WE 390 or permission of the instructor. WE 491 Internship $QRQWKHMREOHDUQLQJH[SHULHQFHUHODWHGWRWKH¿HOGRIVWXG\ $QLQWHUQVKLSLVFRRSHUDWLYHO\VXSHUYLVHGE\D&ROOHJHIDFXOW\ PHPEHUDQGDTXDOL¿HGSHUVRQLQWKH¿HOGZKHUHWKHVWXGHQWLV working. Each internship will culminate with a successful oral SUHVHQWDWLRQ FDSVWRQHH[SHULHQFH WRWKHIDFXOW\RIWKH6SRUW6FL- ence Department. WE 247, 397 Field Experience Field experience affords students an opportunity to engage in QRQFODVVURRPOHDUQLQJXQGHUWKHVXSHUYLVLRQRIDTXDOL¿HGSHU- son. The program is designed to introduce students to a profes- sional area before enrolling in professional courses and to enable WKHVWXGHQWVZKRKDYHFRPSOHWHGVRPHSURIHVVLRQDOFRXUVHVWR apply the principles and techniques acquired to practical situa- tions. Students are expected to analyze critically the situation and WRHYDOXDWHWKHH[SHULHQFHLQOLJKWRIWKHLUFRXUVHZRUNDQGFDUHHU SODQV6WXGHQWVPXVWPDNHDUUDQJHPHQWVZLWKDIDFXOW\VXSHUYL- sor prior to enrolling. Directory 87 THE PRESIDENT ADMISSIONS Gerald E. Wood3UHVLGHQW ±:HVW9LUJLQLD:HVOH\DQ Mark Thompson, 'HDQRI$GPLVVLRQV ±7KLHO&ROOHJH &ROOHJH%$ 0HWKRGLVW7KHRORJLFDO6FKRROLQ2KLR B.A., 1984 0'LY :HVW9LUJLQLD8QLYHUVLW\'(G Brad M. Harsha,$VVRFLDWH'LUHFWRURI$GPLVVLRQV Susan Pscodna([HFXWLYH$VVLVWDQWWRWKH3UHVLGHQW'LUHFWRURI ±'H¿DQFH&ROOHJH%6 0%2/ +XPDQ5HVRXUFHV ±:HVWHUQ0LFKLJDQ8QLYHUVLW\%6 Debra A. Stevens$VVLVWDQW'LUHFWRURI$GPLVVLRQV Judith Lymanstall([HFXWLYH6HFUHWDU\WRWKH3UHVLGHQW 'H¿DQFH&ROOHJH$$ Bryan Albright, 6HQLRU$GPLVVLRQV&RXQVHORU 'H¿DQFH ACADEMIC AFFAIRS &ROOHJH%6 0$ Catharine O’Connell, Vice President for Academic Affairs/ Jennifer L. Stark6HQLRU$GPLVVLRQV&RXQVHORU $FDGHPLF'HDQ ±$PKHUVW&ROOHJH%$ ±%RZOLQJ*UHHQ6WDWH8QLYHUVLW\%$ 'H¿DQFH&ROOHJH 8QLYHUVLW\RI0LFKLJDQ0$ 3K' M.A., 2003 Donald S. Knueve$VVRFLDWH$FDGHPLF'HDQ ±6W Kirk Wensink,$GPLVVLRQV&RXQVHORU ±'H¿DQFH -RVHSK¶V&ROOHJH%6 %$ ;DYLHU8QLYHUVLW\ College, B.S., 2002 06 %RZOLQJ*UHHQ6WDWH8QLYHUVLW\3K' Joyce Nelson, Admissions Secretary and Campus Visit Carolyn M. Gilgenbach)DFXOW\6HFUHWDU\ &RRUGLQDWRU Lucinda Knight)DFXOW\6HFUHWDU\ Sally B. Bissell, Assistant Dean for Adult and Graduate Programs ATHLETICS ±'H¿DQFH&ROOHJH%6 8QLYHUVLW\RI7ROHGR Richard Kaiser,$WKOHWLF'LUHFWRU ±8QLYHUVLW\RI M.Ed., 1995 1RUWKHUQ&RORUDGR%$ 6RXWK'DNRWD6WDWH8QLYHUVLW\ Amy A. Westrick$GXOW3URJUDPV&RRUGLQDWRU 0$ %ULJKDP Kevin Tong+HDG$WKOHWLF7UDLQHU ²2KLR8QLYHUVLW\ INSTITUTIONAL ADVANCEMENT %6 :DJQHU&ROOHJH06(G Bruce Mack9LFH3UHVLGHQWIRU,QVWLWXWLRQDO$GYDQFHPHQW Kathleen Westfall$VVLVWDQW$WKOHWLF7UDLQHU ±2KLR ±0LFKLJDQ6WDWH8QLYHUVLW\%$ 0$ 8QLYHUVLW\%6 8QLYHUVLW\RI3LWWVEXUJK06 8QLYHUVLW\RI0LFKLJDQ3K' Kimberly Church$GYDQFHPHQW6HUYLFHV6HFUHWDU\ FINANCE AND MANAGEMENT Sue Dumire$GYDQFHPHQW6HUYLFHV6HFUHWDU\ Lois N. McCullough, Vice President for Finance and Holli Hesselschwardt, Associate Vice President for Institutional 0DQDJHPHQW ±'H¿DQFH&ROOHJH%6 0%2/ $GYDQFHPHQW ±'H¿DQFH&ROOHJH%6 0$ &3$ Sheri J. McCoy$GYDQFHPHQW6HUYLFHV&RRUGLQDWRU Kristine M. Boland'LUHFWRURI$FFRXQWLQJ ±8QLYHUVLW\ Kathleen M. Punches, 'LUHFWRURI3XEOLF5HODWLRQV of Toledo, B.S., 1991 ±'H¿DQFH&ROOHJH%6 8QLYHUVLW\RI7ROHGR0/6 Lori Shafer0DLODQG&RS\6HUYLFHV&RRUGLQDWRU 2003 ±'H¿DQFH&ROOHJH%$ Ryan Imbrock&RPPXQLFDWLRQV$VVLVWDQW ²%RZOLQJ Linda L. Young$FFRXQWLQJ&OHUN ±'H¿DQFH&ROOHJH *UHHQ6WDWH8QLYHUVLW\%6- B.S., 1993 Lou A. Joost6ZLWFKERDUG2SHUDWRU5HFHSWLRQLVW Cynthia Shaffer'LUHFWRURI3ODQQHG*LYLQJ ²/DQVLQJ FACILITIES MANAGEMENT &RPPXQLW\&ROOHJH$$ 'H¿DQFH&ROOHJH%$ Karen Pierce, )DFLOLWLHV0DQDJHPHQW&RRUGLQDWRU Kathleen Thompson'LUHFWRURI$OXPQL5HODWLRQV Matthew Slawinski$XGLR9LVXDO&RRUGLQDWRU ±%RZOLQJ – Central College, B.A., 1987 *UHHQ6WDWH8QLYHUVLW\%$ Michele Tinker'HYHORSPHQW2I¿FHU ±2KLR8QLYHUVLW\ B.S., 1974 FINANCIAL AID Amy A. Francis'LUHFWRURI)LQDQFLDO$LG ²'H¿DQFH McMASTER SCHOOL College, B.S., 1990 Fran Coonrod, 6HFUHWDU\ ±'H¿DQFH&ROOHJH$$ Michael Jacobs, $VVLVWDQW'LUHFWRURI)LQDQFLDO$LG Craig Rutter'LUHFWRURI6HUYLFH/HDUQLQJ %RZOLQJ ±'H¿DQFH&ROOHJH%6 0$ *UHHQ6WDWH8QLYHUVLW\%6 0(G Jeannie VonDeylen, )LQDQFLDO$LG6SHFLDOLVW ) Donald H. Buerk, Co-Director of Carolyn M. Small Honors 3URJUDPDQG$VVLVWDQW3URIHVVRU+LVWRU\ ±%RZOLQJ PHYSICAL PLANT *UHHQ6WDWH8QLYHUVLW\%6 0$ Terry L. Eis6XSHUYLVRURI3ODQW2SHUDWLRQV Mary Ann Studer, Co-Director of Carolyn M. Small Honors Sherry Steingass, Secretary for Physical Plant and Health 3URJUDPDQG$VVLVWDQW3URIHVVRU3K\VLFDO6FLHQFH 6HUYLFHV ±8QLYHUVLW\RI7ROHGR%6 8QLYHUVLW\RI1RUWK'DNRWD Ted J. Czartoski0DLQWHQDQFH7HFKQLFLDQ 0HFKDQLFDO M.S., 1998 Stephen W. Elchinger0DLQWHQDQFH7HFKQLFLDQ Carson Kosier0DLQWHQDQFH7HFKQLFLDQ STUDENT LIFE Mark A. Kunesh0DLQWHQDQFH7HFKQLFLDQ +9$& Ellen P. Servetnick, 'HDQRI6WXGHQW/LIH ±7KH*HRUJH Jeffery L. Niese0DLQWHQDQFH7HFKQLFLDQ :DVKLQJWRQ8QLYHUVLW\%$ )UDPLQJKDP6WDWH&ROOHJH David L. Smart*URXQGVNHHSHU M.A., 1983 Tom L. Stevens0DLQWHQDQFH7HFKQLFLDQ (OHFWULFDO Jason A. Gross$VVLVWDQW'HDQRI6WXGHQW/LIH ± :KHHOLQJ-HVXLW8QLYHUVLW\%$ 0%$ REGISTRATION CENTER Sandra E. Hillman$GPLQLVWUDWLYH$VVLVWDQW Connie Klingshirn'LUHFWRURI5HJLVWUDWLRQ6HUYLFHV Janice L. Bechtel&DPSXV&KDSODLQ ±%RZOLQJ*UHHQ ±'H¿DQFH&ROOHJH%6 0%2/ 6WDWH8QLYHUVLW\%)$ (DUOKDP6FKRRORI5HOLJLRQ Andrea M. Jeffery6HQLRU5HJLVWUDWLRQ$VVRFLDWH 0'LY ±8QLYHUVLW\RI7ROHGR$$ Josh Busch'LUHFWRURI6WXGHQW$FWLYLWLHV Elaine M. Wirick6HQLRU5HJLVWUDWLRQ$VVRFLDWH Mercedes Clay'LUHFWRURI0XOWLFXOWXUDO$IIDLUV ±$VKODQG8QLYHUVLW\%$ Karen L. Schroeder&RRUGLQDWRURI+HDOWK6HUYLFHV – Bluffton College, B.S., 1988 Carole L. Thomas, Director of Career and Student Assistance ²3XUGXH8QLYHUVLW\%$ 0$ Tracy Armey&DUHHUDQG6WXGHQW$VVLVWDQFH&RRUGLQDWRU – Northwest State Community College, A.A., 1994 Directory 89 EMERITI ADMINISTRATION Michael J. Gallagher$VVRFLDWH3URIHVVRU$FFRXQWLQJ Marvin J. Ludwig3UHVLGHQW(PHULWXV ±/HEDQRQ9DOOH\&ROOHJH%6 0%$ 8QLYHUVLW\ Raymond J. Derricotte&RQWUROOHU(PHULWXV of Toledo, Ph.D., 1998 Richard W. Stroede,'HDQ(PHULWXV Nathan Griggs$VVLVWDQW3URIHVVRURI0LFURELRORJ\ ±3XUGXH8QLYHUVLW\%6 %6& :ULJKW6WDWH EMERITI FACULTY 8QLYHUVLW\3K' Mary Catherine Harper$VVLVWDQW3URIHVVRU(QJOLVK William O. Chaney0$ (QJOLVK ±0RQWDQD6WDWH8QLYHUVLW\%$ %RZOLQJ*UHHQ6WDWH Horace H. Everett0$ (GXFDWLRQ 8QLYHUVLW\3K' Eugene R. Andrews0$ +LVWRU\ Charles S. Hobgood, Professor, Social Work, Director of Student Garnett M. Smith06 %XVLQHVV(GXFDWLRQ 5HWHQWLRQDQG)UHVKPDQ([SHULHQFH ²:HVWPLQVWHU Maxie J. Lambright-/6 (GXFDWLRQ &ROOHJH%$ 8QLYHUVLW\RI3LWWVEXUJK06: Bernard Mikula3K' %LRORJ\ Diane L. Kaiser, Co-Director of Teaching and Academic Growth Richard Small0(G 3K\VLFDO(GXFDWLRQ &HQWHU 6WXGHQWV ±0LFKLJDQ6WDWH8QLYHUVLW\%$ Hermann Wiebe0$ *HUPDQ 1970, M.A., 1992 Henry Diehl06 0DWKHPDWLFV Donald S. Knueve3URIHVVRU&ULPLQDO-XVWLFH ±6W Carolyn M. Small%6 0XVLF -RVHSK¶V&ROOHJH%6 %$ ;DYLHU8QLYHUVLW\ Randall L. Buchman0$ +LVWRU\ 06 %RZOLQJ*UHHQ6WDWH8QLYHUVLW\3K' Robert B. Boehm3K' +LVWRU\ Robert A. Kohl3URIHVVRU(FRQRPLFV ±8QLYHUVLW\RI Harry G. Miller3K' 3K\VLFV 3LWWVEXUJK%$ 'XTXHVQH8QLYHUVLW\0$ 6WDWH Richard W. Thiede3K' &RPPXQLFDWLRQ 8QLYHUVLW\RI1HZ *UHHQ6WDWH8QLYHUVLW\%6 0(G Frank O. Sanders, Associate Professor, Psychology and Social :RUN ²8QLYHUVLW\RI0LFKLJDQ%$ 0$ M.S.W., 1973 Noreen M. Schaefer-Faix, Associate Professor, Communication ±.HQW6WDWH8QLYHUVLW\%6(G -RKQ&DUUROO 8QLYHUVLW\0$ .HQW6WDWH8QLYHUVLW\3K' Eric J. Schurter$VVRFLDWH3URIHVVRU&KHPLVWU\ ±8QLYHUVLW\RI0LQQHVRWD%6 8QLYHUVLW\RI:LVFRQVLQ %6 3XUGXH8QLYHUVLW\3K' Barbara J. Sedlock$VVRFLDWH/LEUDULDQIRU7HFKQLFDO6HUYLFHV $VVRFLDWH3URIHVVRU ²+LUDP&ROOHJH%$ 8QLYHUVLW\RI.HQWXFN\06LQ/6 Steven J. Smith3URIHVVRU$UW ²%OXIIWRQ&ROOHJH %$ %RZOLQJ*UHHQ6WDWH8QLYHUVLW\0$ 0)$ 1979 Steven Sondergaard, Associate Professor, Criminal Justice ±7HUUD7HFKQLFDO&ROOHJH$$6 3IHLIIHU&ROOHJH $% 8QLYHUVLW\RI'D\WRQ-' Michael T. Soper3URIHVVRU+LVWRU\ ±5XWJHUV 8QLYHUVLW\%$ 8QLYHUVLW\RI:LVFRQVLQ0$ Ph.D., 1971 David Stuckey$VVLVWDQW3URIHVVRU0DWKHPDWLFV ±'H¿DQFH&ROOHJH%6 0LDPL8QLYHUVLW\0$ Mary Ann Studer, Assistant Professor, Physical Science and &R'LUHFWRURI&DURO\Q06PDOO+RQRUV3URJUDP ±8QLYHUVLW\RI7ROHGR%6 8QLYHUVLW\RI1RUWK'DNRWD M.S., 1998 Cynthia Studrawa, Interim Director of Athletic Training (GXFDWLRQ ±&HQWUDO0LFKLJDQ8QLYHUVLW\%6 0LDPL8QLYHUVLW\0$ Kevin M. Tong, Assistant Professor, Sport Science and Head $WKOHWLF7UDLQHU ±2KLR8QLYHUVLW\%6 :DJQHU College, M.S. Ed., 1997 Susan C. Wajert, Associate Professor, Business Administration and Coordinator of Master of Business and Organizational /HDGHUVKLS3URJUDP ²%RZOLQJ*UHHQ6WDWH8QLYHUVLW\ %61 8QLYHUVLW\RI7ROHGR0%$ 7KH8QLRQ Institute, Ph.D., 1997 Jeffrey S. Weaner, Professor of Sociology and Social Work ±'H¿DQFH&ROOHJH%6 :HVW9LUJLQLD8QLYHUVLW\ M.S.W., 1976 Jeanne P. Williams$VVLVWDQW3URIHVVRU&RPPXQLFDWLRQ ±:HVW9LUJLQLD8QLYHUVLW\%6 0DUVKDOO8QLYHUVLW\ 0$ 2KLR6WDWH8QLYHUVLW\3K' Alesia Yakos-Brown$VVLVWDQW3URIHVVRU6RFLDO:RUN ±'H¿DQFH&ROOHJH%6 2KLR6WDWH8QLYHUVLW\06: ,QGH[ 91 --A-- admission decision, 10 Academic grades, 29 accommodations policy, 18 Art DGYLVLQJ curriculum, 32, 53-54 calendar, 3, 4 Arts and Humanities GLYLVLRQV curriculum, 32, 53 honors, 30 GLYLVLRQ PDMRUV Assessment, 7 policies, 28-30 Assistance, student, 17 probation, 30 Associate of Arts Degree progress, 15-16 curriculum, 21 scholarships, 15 requirements, 22 second chance, 29 Athletic Eligibility, 30 societies, 18 Athletic Training Education, 32-33, 54-55 withdrawal, 28 Attendance policy, 28 year, 20 Auditing courses, 28 Accounting, 31, 53 Accounts, payment, 12 --B-- Accreditation, 7 %DFFDODXUHDWH %DFKHORU 'HJUHH Admission, 8-10 curriculum, 21 DGYDQFHGSODFHPHQW general education requirements, 23 DGYDQFHGSODFHPHQWFUHGLWV requirements, 22 appeal procedure, 9-10 PDMRUV application, 14 %HKDYLRUDODQG$SSOLHG6RFLDO6FLHQFHV'LYLVLRQ application fee, 8 Biology, 33, 56-57 FDPSXVYLVLW Business criteria, 9 curriculum, 33-34 decision, 9-10 GLYLVLRQ deposit fee policy, 10 Business Administration, 33-34, 55-56 dual enrollment, 9 former student, 9 --C-- how to apply, 8 Calendar, 3, 4 international students, 9 &DPSXVYLVLW non-matriculated students, 10 Campus work, 14 post secondary option, 9 Career and Student Assistance, 17 requirements, 8 Center for Adult and Graduate Programs, 20 student re-enrollment, 9 &HUWL¿FDWLRQWHDFKHU transfer students, 10 Chemistry, 34, 60-61 transient students, 9 Christian Education, 46-49 tuition deposit, 9 &KXUFKDI¿OLDWLRQ when to apply, 8 &KXUFK(GXFDWLRQ&HUWL¿FDWH3URJUDP $GYDQFHGSODFHPHQW &LYLO5LJKWV5DFLDO+DUDVVPHQW3ROLF\ $GYLVLQJ Class attendance, 28 Appeals schedule changes and withdraws, 28 standing, 28 ,QGH[ 92 CLEP exams, 25 (QYLURQPHQWDO6FLHQFH Commencement, 18 (YHQLQJVHVVLRQ Communication Arts, 34-35, 58-60 Examinations Complaint Policy, 7 credit by, 25 &RPSXWHU6FLHQFH VHH,QIRUPDWLRQ7HFKQRORJ\ CLEP, 25 &RQ¿GHQWLDOLW\VWXGHQWUHFRUGV DANTE, 25 &RRSHUDWLYH(GXFDWLRQ Expenses, 11 Correspondence credit, 25 Costs, 11 -- F -- Course Faculty and staff directory, 87-89 descriptions, 53-86 Fees, 11 loads, 28 Field experience, 27 withdrawal, 28 Finance, 38-39, 69 &RYHQDQW'H¿DQFH&ROOHJH Financial aid, 14-16 Credit by examination, 25 application, 14 Criminal Justice, 35, 61-62 campus work, 14 categories, 14-15 --D-- grants, 14 DANTE exams, 25 loans, 15 Dean’s List, 30 policies, 12-13 'HFODUDWLRQRIPDMRU refunds, 12-13 Deferred payment plans, 12 satisfactory academic progress, 15-16 Degree requirements scholarships, 15 associate’s, 22 Financial policy, 12-13 bachelor’s, 22-23 Financial status, 12 Design for Leadership, Forensic Science, 39 Religious Education, 46-49 Freshman Seminar 69 Directory faculty/staff, 87-89 --G-- information release, 30 General education requirements,, 23 'LYLVLRQVWUXFWXUH General information, 5 Dropping courses, 28 General Studies, 39, 70 Geography, 39, 70 --E-- *UDGHSRLQWDYHUDJH *3$ Economics, 35-36, 62 Grade reports, 30 Education Grading system, 29 adolescent and young adult, 37-38 Graduate curriculum, 20-21 curriculum, 36-38, 62-68 Graduate/Undergraduate course policy, 29 'LYLVLRQ Graduation honors, 31 Early Childhood, 36-37 Graduation requirements Middle Childhood, 37 Associate of Arts degree, 22 Multi-Aged 38 Bachelor of Arts degree, 22-23 Educational philosophy, 5 Bachelor of Science degree, 22-23 Emeriti faculty directory, Grants, 14 English, 38, 68-69 Graphic Design, 39 ,QGH[ 93 Mission statement and purposes, 5 --H-- Multimedia Communication, 44-45 Health curriculum, 39, 70-71 Music Health insurance fee, 11 DFWLYLWLHV History, 40, 71-72 curriculum, 76 History of the College, 5 fees, 11 Home Schooled Students, 8 McMaster School, 27 Honor societies, 18 Honors --N-- academic, 31 Natural Science graduation, 31 curriculum, 45, 76-77 list, 31 'LYLVLRQ Housing, 11 Nondiscrimination statement, 7 Human Resource Management, 40 Non-traditional credit, 25 How to Apply, 8 -- O -- --I-- Off-campus programs, 26-27 Incomplete grades, 11 On-campus programs, 24-26 Independent study, 26 2UJDQL]DWLRQDO/HDGHUVKLSDQG6XSHUYLVLRQ Information Technology, 40-41, 73-74 2YHUORDGIHH Integrated Language Arts, 41 Integrated Mathematics, 41-42, 74-75 -- P -- Integrated Social Studies, 42 Part-time student fees, 11 International Students admission, 9 Pass-fail option, 29 Internships, 27 Payment of accounts, 12 Physical Education, 45-46, 77-79 -- L -- Physics, 46, 79-80 Learning outcomes, 6 3LOJULP/LEUDU\VHUYLFHV /HDYHRIDEVHQFH 3ODFHPHQWVHUYLFH Life Science, 42 Political Science, 46, 80 Life Science and Chemistry, 42-43 Pre-Professional Programs, 24-25 Loans, 15 3ULYDF\DFW Probation/Suspension, 30 --M-- Programs of study, 31-52 0DMRUGH¿QLWLRQ Psychology, 46, 80-81 0DMRUUHTXLUHPHQWV Public Relations, 34-35 Management 43, 75 Marketing, 43-44, 76 --R-- Mathematics, 44, 74-75 Readings, 26 Meals, 11 Readmitted students, 9 Medical Technology, 44 Recreation, 45-46 Midterm grades, 30 Refunds, 12-13 0LOLWDU\$FWLYH'XW\ Registration, 28 0LQRUGH¿QLWLRQ ,QGH[ 94 Religious Studies/Christian Education, 46-49, 81-83 Transfer credit, 25 Repeating courses, 29 Transfer students, 9 Restoration Ecology, 49 Transient students, 9 Tuition and fees, 11 --S-- deposit, 10 Satisfactory academic progress, 15-16 payment schedule, 12 Schedule changes, 28 prepayment, 12 Scholarships, 14-15 refunds, 12 6FLHQFH VHH1DWXUDO6FLHQFH Tutoring and other academic support, 17 Second Baccalaureate degree, 23 6HOIGHVLJQHGPDMRUV --U-- Senior citizen fees, 11 8QLWHG&KXUFKRI&KULVWDI¿OLDWLRQ 6HUYLFHOHDUQLQJ Sexual/gender harassment statement, 18-19 -- V -- Social Work, 49-50, 84-85 Visual Arts, 51 Sociology, 50, 83-84 Spanish 50, 84 Special academic programs -- W -- off-campus, 26-27 Weekend College, 20 on-campus, 24-26 Wellness, 52, 86 Sport Management, 50-51, 83 Withdrawal Sport Science, 51 from college, 13 Student from courses, 28-29 accommodations policy, 18 When to Apply, 8 appeals, 10, 29 assistance, 17 FLYLOULJKWVUDFLDOKDUDVVPHQWSROLF\ complaint policy, 7 designed courses, 26 handbook, 17 3LOJULP/LEUDU\VHUYLFHV records, 30 re-enrollment, 9 6WXGHQWGHVLJQHGPDMRUSURJUDPV Student teaching fee, 11 requirements, 36-38 Study abroad, 27 Summer session, 20 Suspension from college, 30 --T-- Teacher Licensure, 36-38 Transcripts, 30 Notes 95 Notes 96