EZH1 antibody - N-terminal region (ARP38092_P050) Data Sheet
Product Number ARP38092_P050 Product Name EZH1 antibody - N-terminal region (ARP38092_P050) Thumbnail Label Human COLO205 Size 50ug Gene Symbol EZH1 Alias Symbols KIAA0388; KMT6B Nucleotide Accession# NM_001991 Protein Size (# AA) 747 amino acids Molecular Weight 85kDa Product Format Lyophilized powder NCBI Gene Id 2145 Host Rabbit Clonality Polyclonal Official Gene Full Name Enhancer of zeste homolog 1 (Drosophila) Gene Family KMT This is a rabbit polyclonal antibody against EZH1. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQ Target Reference van (1998) Mol. Cell. Biol. 18 (6), 3572-3579 EZH1 is a component of a noncanonical Polycomb repressive complex-2 (PRC2) that mediates methylation of Description of Target histone H3 (see MIM 602812) lys27 (H3K27) and functions in the maintenance of embryonic stem cell pluripotency and plasticity. CDKN1A, CTNNB1, FHL2, FOXG1, SIRT1, SMAD3, SMAD4, AKT1, AR, CEBPB, CREBBP, CSNK1G1, Partner Proteins CTNNB1, DYRK1A, ESR1, FHL2, FOXG1, G6PC, GSK3B, HNF4A, HOXA10, HOXA5, PAK1, PPARG, RARA, SIRT1, SMAD3, SMAD4, SRC, THRB, YWHAG, YWHAZ, AR, CEBPB, CREBBP, ESR1, HNF4A, HOXA5, RFWD2, SMAD3, SMAD4, SRC, TSC2, YWHAG, YW Reconstitution and Add 50 ul of distilled water. Final anti-EZH1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-EZH1 antibody is Catalog # AAP38092 (Previous Catalog # AAPP20266) Immunogen The immunogen for anti-EZH1 antibody: synthetic peptide directed towards the N terminal of human EZH1 Swissprot Id Q92800 Protein Name Histone-lysine N-methyltransferase EZH1 Sample Type Confirmation There is BioGPS gene expression data showing that EZH1 is expressed in COLO205 Protein Accession # NP_001982 Purification Affinity Purified Species Reactivity Bovine, Rat, Dog, Pig, Horse, Rabbit, Guinea pig, Human, Mouse, Zebrafish Application IHC, WB Predicted Homology Based on Immunogen Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86% Sequence
Human COLO205
WB Suggested Anti-EZH1 Antibody Titration: 0.2-1 ug/ml ug/ml ELISA Titer: 1:1562500 Positive Control: COLO205 cell lysate There is BioGPS gene expression data showing that Image 1 EZH1 is expressed in COLO205
______
This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.