Purchase a $2.2M$2,200,000 $2,100,000 NEW Vehicle in $2,000,000$2.0M May & we’ll give $1,900,000 you & 2 friends or $1,800,000 family a combined $1,700,000 $1,600,000 $500 in gift MOTORS $1.5M$1,500,000 CERTIÛCATESTO $1,400,000 local businesses TOLLTOL FREE: 1 (888) 842-4471 $1,300,000 affected by 2110211 15 Ave. Wainwright, AB $1,200,000 Come and Visit Us at $1,100,000 #localbusinesshelpinglocalbusiness Covid 19 www.wainalta.com $1.0M$1,000,000 $900,000
$800,000
$700,000
$600,000
HWY. 14 EAST $500,000 780-842 5518 $0.5M WAINWRIGHT $400,000
OPEN MON-SAT 10AM -5PM $300,000
We are here to provide all your home Essential $200,000 needs while striving to save you more! $100,000
Come in and see us, $000,000 PLEDGED COMMITMENT call 780-842-5518 to talk to our sales team CT SCANNER PROJECT Curb side pickup, driveway delivery Building Better Communities Instore Promotions Storewide! Donations can be made at all May 8, 2020 Financing available! Wainwright Banks and Each Star News Inc. Wainwright AB. Volume 7 Number 29 Our mission: To serve our readers with news and advertising of high integrity. Encompass Credit Union in the area. MD of Wainwright to open campgrounds and golfing May 15 Camping restricted to residents of the MD Roger Holmes [email protected]
ampgrounds in the MD of Wain- Cwright will open May 15th in time for the May long weekend. Camping will be available only to residents who live within the bound- aries of the MD of Wainwright which includes residents of the towns and villages in the MD. Reservations by phone will be available shortly includ- ing a limited number of stalls for the full season. No group camping sites This Ribstone campground on Highway 14 north of Ribstone is oper- will be open until further notice. ated by the MD of Wainwright and will be open to campers on May 15. Campers will be required to have 100% self-contained water and sewer in their camping units. Power will be bler’s Lake, Fabyan and Ribstone. Sig- VID-19 spacing. on where available. Water and sewer nage is expected to be installed at the Councilors hookups will be operational where camp grounds outlining the current made the deci- present at the various locations. No restrictions. sion in a regular public washrooms or club houses will Provincial camping restrictions re- and budget meet- be open. Tent only camping will not be quire no more than 50 per cent of the ing on Tuesday allowed. campgrounds are to be occupied and it May 5th. They Campgrounds in the MD affected are is expected that every second camping also noted this Salt Lake, Riverdale, Arm Lake, Am- site will be left vacant to allow for CO- decision is subject to change upon further notice as the requirements of the pandemic evolve. Golfing will M.D. of Wainwright employee Dusty Widdowson approaches the also be open on hole as he works on a green Wednesday May 6, at Riverdale Mini Park May 15th at the with a Viticutting machine to get the course ready for opening on May Riverdale and 15. The course and the camping will open with some restriction for the Arm Lake fa- long weekend. cilities. No daily green fees will be accepted. Golfing will age of 25 are $50. be restricted to seasonal members only. Other restrictions may apply. No Family memberships are available for rental carts will be available; however, $200 which includes parents and de- golfers will be allowed to use their own pendent children up to 17 years of age carts. Arrangements for tee times will living in the same household. Individ- be required and have to be made by The Amblers Lake Campsite north of Irma that is operated by the MD Photos: Roger ual memberships are $125 and student telephone. Toilet facilities on the cours- had lots of space for COVID-19 spacing. This and all the other MD camping Holmes memberships including those up to the es will be closed. EDGE sites will be open for the May long weekend.
“We love to make you smile”
$FFHSWLQJ1HZ3DWLHQWV! Dr. Nordstrom Dr. Jacob (780) 842-6838 Dr. Chauhan 2 EDGE | Wainwright, AB | May 8, 2020 No new COVID-19 cases in Wainwright More than half of Alberta’s COVID-19 cases have recovered
Zak McLachlan well, AHS resumed some scheduled, nightclubs; and in-school classes for [email protected] non-urgent surgeries, and health care K-12 students. services such as dentistry, physiothera- The start of stage two will depend on ainwright still has yet pists, dieticians, respiratory therapists how successful stage one is throughout Wto have any new con- and more could resume practice. the province. firmed cases of COVID-19 Stage one of the relaunch may come Some of the highlights of stage two since the single case became listed as wright and the surrounding area, has as early as May 14 once certain health are the potential re-opening of in- recovered a couple weeks ago. seen the slowest growth in confirmed measures are reached. school classrooms, some larger gather- The number of confirmed cases in cases. As of Wednesday, the zone has Stage one highlights include the re- ings, the opening of movie theatres and the province continues to climb, but so reported 91 cases since the pandemic opening of certain retail businesses some personal services such as cosmet- does the number of recovered cases. began. such as clothing, furniture and book ic skin and body treatments, manicures, On Wednesday, the province report- A total of 160,185 people in Alberta stores as well as some personal services pedicures, massages and reflexology. ed 72 new cases over the past 24 hours, have tested for COVID-19. such as hairstyling and barber shops. Stage three, when the time comes, with six more deaths. Premier Jason Kenney announced Daycares, out-of-school care and will be a full re-opening of all other in- But the number of recovered cases Alberta’s COVID-19 relaunch, with summer camps will be able to open dustries, but some restrictions will still is climbing quickly. Of the 5,963 cases early actions taking effect almost im- with limits on occupancy. apply. confirmed within Alberta, 3,552 have mediately. Things still not permitted in stage Throughout all stages of the relaunch, been classified as recovered. A total of The early actions included a number one include gatherings of more than 15 physical distancing of two metres and 112 people have died in Alberta from of outdoors and recreational activities people; festivals, major sporting events personal hygiene requirements will re- COVID-19. including the opening of golf courses, and concerts; movie theatres, public main in place. The Central zone, home to Wain- boat launches and many campsites. As pools, recreation centres, gyms and EDGE LET’S TALK TAXES. MAXIMIZE YOUR REFUND WITH H&R BLOCK. Scribner Auction helping With over 50 years of experience, it's easy to see why Canadians trust H&R Block with their taxes. From a simple return to complex one, our trained Tax Experts can help you get the most back. Make H&R Block your advantage: Maxium Refund Guarantee* local retail businesses 7&+655+56#0%' '#4g4170&Service For more info, visit an H&R Block location near you. Wainwright AB during COVID-19 780 842 3146 HRBLOCK.CA *If you discover an H&R Block error on your return that reduced your refund (or increased your liability), we will amend the return at no Zak McLachlan additional charge to correct our error. If H&R Block makes an error in the preparation of your tax return that costs you any interest or penalties on additional taxes due, although we do not assume the liability for the additional taxes, we will reimburse for the interest and penalties.
an EDGE 4-pack [email protected]
OVID-19 has been tough on local businesses, Cespecially retail businesses which do not Irma have online selling capabilities. But one local business stepped up to help out We can supply: variety of feed products for large by holding an online auction to sell merchan- dise for retail businesses in Wainwright. animals (horses, cattle, sheep & more) Scribner Auction hosted a Shop Local Auction SPECIAL ORDERS. WEEKLY SHIPMENTS. online on Saturday, May 2. They reached out to Scribner Auction auctioned off many items Facebook CALL FOR MOR DETAILS. a number of local businesses, who were happy from local businesses at their Shop Local Auction photo to have an outlet to sell some merchandise and on May 2, to help brick and mortar businesses Huge selection of ammunition in stock at great prices. generate some income while the pandemic has sell some stock while their stores are closed. Dry Goods Fresh Meats & Produce Seasonal forced their brick and mortar businesses to tem- Hardware Cardlock porarily close. hashtag #NotEssentialButEssential, which was The online auction featured a wide variety of started by Scribner when the pandemic began TEMPORARY HOURS: MON - FRI 10AM - 6PM SAT 10AM - 5PM items, with things ranging from home decor to forcing businesses to close, says it all. an EDGE 4-pack off road vehicles to currency and much more. “We want those businesses to be here when Katrina Scribner said the idea just came out of this is over, and if they’re not able to make any a conversation about sympathy for local busi- income or are just relying on the government, nesses who do not have online selling capabili- that’s not enough. These people need sales. ties. The Scribner Auction team took that conver- And they were helping us too, because we got a sation and turned it into the event which was cheque out of it,” she said. attended online by people from coast to coast. “We all managed together to give each other a “There’s a lot of those businesses who don’t cheque. As a local business ourselves, and these have online stores, especially antique stores businesses hiring us to sell their things, it formed who aren’t online at all,” Scribner said. a partnership to put a little something in every- “It was just a way to put cheques in the hands body’s cash drawer.” of people who needed it.” The sale included items from a number of She said it was a great way for Scribner Auc- businesses in Wainwright such as Toys & Trea- tion to support other local business, while those sures, Iron Raven and Don’s Speed Parts as well businesses also supported Scribner Auction. The as some local residents. Scribner Auction also donated a por- tion of the online buyer’s premiums *"# "$*# to the Wainwright Food Bank. EDGE !%("$* $" )#(!#*# # !'*!! "" * #&$& LANDSCAPING DON’S * #%!#*"#) !# LAWN & GARDEN LTD. Taking Bookings for ! $($*!(# ! ! ! Spring Packages *!( *#% Dean ! *!%!% *! ! Christensen ! Call for a FREE ESTIMATE ! " " 780-806-0188 ! ! email: [email protected] an EDGE 4-pack EDGE | Wainwright, AB | May 8, 2020 3 Discussions from Wainwright Town Council May 5
Zak McLachlan lieves they can handle it. [email protected] “In an emergency man- agement role, opening up a lot of places least we can get some people in there,” “When they came and approached us, whether it be golf courses or salons or Walker said. it was to pay for a summer student. But he Council of the Town of Wain- whatever is going to start opening up Councillor Ariel Haubrich said it will if (the VIC) is not open and the museum wright met via GoToMeeting for their T the possibility and probability of seeing be good to open the campground and is not open, I don’t think we should be regular meeting on Tuesday, May 5, with more contact cases (of COVID-19) rise. give people a place to stay during the releasing any funds to them,” said Coun- a number of items to discuss. We want people to remember, regard- summer months. cillor Will Challenger. Fire Chief’s update on grass fire less of whether a business is open, social “I think it’s a good opportunity to see “If they had come to us and said we season, COVID-19 responsibilties distancing and all other safety measures how it goes. Middlemass has typically aren’t opening, but we’re going to take Wainwright Fire and Rescue Fire are still completely in place,” he said. been used by a lot of workers, and they on a project or do something online in- Chief Steve Douglas said grass fire sea- “Also, with more things that open up still need to be here to work. If that’s a stead, then certainly we would support son is well underway, and the local de- with campgrounds and things like that safe way for us to support them, I think them. But if they’re not opening and partment has responded to a number of comes more fires or injuries. So that does that’s good as long as everybody is fol- not hiring anybody, I think it’s prudent grass fires already this spring. With a dry add to some of the stuff that fire and lowing the rules,” she said. to conserve our funds,” Councillor Ariel emergency response has to do. And with and increasingly warm spring, Fire Chief Discussions on funding requests Haubrich said. the ambulances and AHS being used Douglas said the volume of grass fires is Councillor Bruce Pugh said he would pretty heavily, more of that falls on us. With nearly all events and numerous typical, and thankfully none of them like to look in to whether or not the VIC So we’re trying to stay diligent.” seasonal operations shut down for the have been caused by any wrongdoing. has any other costs that they will strug- summer, Council discussed whether or “This is usually pretty typical for this Dr. Middlemass Park gle to cover over the summer. not they should still be honouring fund- time of year for grass fires. Last year was Campground set to open May 15 “If they were banking on having mon- ing requests from local organizations a bit of an anomaly with the wetter ey from the restaurant, then they can be Town Parks and Rec Director Scott which were set to host events this sum- spring than normal and a slower grass hurting. I’m not saying we give them Walker said Dr. Middlemass Park Camp- mer. fire season,” the Fire Chief said. the original proposed amount, but if ground will open on May 15, while fol- Councillor Bob Foley, a longstanding “We haven’t had any negligence or they’re still looking to have some kind of lowing the parameters set out by the member of the Wainwright Stampede anything caused by anybody not fol- identity out in the community, maybe province. Association, brought up the topic, say- lowing their permit, so that’s good. So they can send a letter and we can figure Campers will have to remain con- ing he doesn’t believe the Association’s really this is pretty normal for this time something out,” Councillor Pugh said. tained to their own site, only every other funding request should be honoured of year.” Councillor Foley said it would be wise site will be occupied and there will be no since there is no Stampede. Fire Chief Douglas added that with for Council to remain flexible, as things fires or access to public washrooms al- That and a letter from the Visitor In- the Government of Alberta announcing are changing quickly. lowed. formation Centre (VIC) stating they will businesses in the province will begin re- “With the museum, they’re not plan- “We think it will be a good opportuni- be closed for the year but would still be opening in phases, there will be added ning on opening. But if they do open, ty to open, but to do it in a safe manner. happy to receive some funding sparked strain on the fire department and local I think we should have a plan to give That means there will only be about 14 a conversation about other funding re- emergency management. But he be- them some funds in that case,” he said. sites available, which isn’t many. But at quests received earlier in the year. EDGE There’s a new constable in town
Zak McLachlan ewan as well as giving their children a Gardipee said he enjoys spending time [email protected] great community to live. volunteering and being involved in “We wanted a small town to police sports. in that was pro-police and had a lot of “I’m big into volunteering, so I’ll be onstable Mitch Gardipee and his amenities for our kids. We’re very hap- a member of the Kinsmen Club here, family rolled into town just about C py so far. We’ve only been here a week which is great that there is one here. two weeks ago, and he is already and a half, and it’s awesome so far,” Cst. Sports and recreation is big in this com- happy to be a part of the Wainwright Gardipee said. munity, so that’s the kind of stuff I’m RCMP Detachment and the commu- After shifting his focus from studying looking forward to,” he said. nity in Wainwright. to by a gym teacher to working in the Other volunteering experience on Cst. Gardipee is originally from cen- oilfield and then to a career in policing, his resume includes coaching youth tral Alberta and has been a member of Cst. Gardipee said he is happy he made soccer, high school football, club vol- the RCMP for the past 13 years, spend- ing eight years in Saskatchewan and the choice to apply to join the RCMP. leyball and floor hockey teams. the past five years traffic enforcement “I enjoy making the community safe He said he was disappointed to see in Ponoka. and getting to know everybody. I bring activities like slopitch cancelled due to He and his family chose to come to Constable Mitch Gardipee, the newest a lot of policing experience to the com- COVID-19, but he looks forward to get- the Wainwright Detachment to be member of the Wainwright RCMP Deach- munity, and I’m really excited to be ting involved in the community once ment, said he is excited to be in Wainwright closer to his wife’s family in Saskatch- here,” he said. the pandemic clears up. and looks forward to getting involved in the When he is not in uniform, Cst. EDGE community. Photo: Zak McLachlan
1829 1A-ST CRES 530-2ND AVE CRES 1806-2A ST CRES 701-9 AVE 1653-6TH AVE MLS 65774 MLS 66283 MLS 66457 MLS 65787 MLS 66294 $159,900 $164,900 $179,900 $252,000 $269,900 Valerie Moroz Broker/Realtor Licensed since 1985 780-842-0343
Here to help you with your home sales & purchasing 518-22 ST 513-20th St 521-20TH ST 1826-10TH AVE 102 MAIN ST GREEN- during this unique time-with precautions! MLS 66167 MLS 66352 MLS 66350 MLS 66331 SHIELDS MLS 66090 ŏ/HWPHKHOS\RXƓQG\RXUKRPHŐ Valerie $329,900 $334,900 $337,000 $349,900 $354,900 VALERIE’S LISTINGS [email protected] 4 EDGE | Wainwright, AB | May 8, 2020 Family Recipes Served with l ve By Phyllis Holmes [email protected]
SOURDOUGH BREAD PLFURZDYHURRPWHPSHUDWXUHZDWHUIRU Loaves of sour dough rising in their floured towel-lined bowls This week I tackle making sourdough bread using VHFRQGV only sourdough starter. My son advises I should use 2 ½ teaspoons of salt a scale and I think about it, but I am reluctant to &RPELQHWKHVWDUWHU$OOSXUSRVHëRXU:KROH add another piece of equipment to my kitchen. The :KHDWëRXUDQGZDUPHGZDWHULQDODUJHERZO0L[ beauty of sourdough bread for me is its simplicity. It well, stirring until the mixture forms a mass. The LVDPD]LQJWRPHWKDWëRXUDQGZDWHUFDQEHWUDQV dough should be soft and a little sticky. IRUPHGLQWRDOLYLQJWKLQJ,êQGLWYHU\VDWLVI\LQJ 2. Cover the dough with a towel and let it sit for 20 to watch the starter begin to bubble away in what PLQXWHV7KLVUHVWDOORZVWKHëRXUWRDEVRUEWKHZDWHU seems to me a very happy state. $GGWKHVDOWDQGNQHDGWKHGRXJKJHQWO\XQWLOLW There are many variables to contend with and these is smooth, soft and a little tacky. Place the dough in need to be addressed while working through the a bowl and cover it with a towel or saran wrap and SURFHVVRIêUVWPDNLQJWKHVWDUWHU 7KH(GJH0D\VW leave it to rise for an hour in a warm place. and then using this starter as the natural leaven for the breadmaking process. Chief among the variables 3ODFHDVPDOODPRXQWRIëRXURQWKHFRXQWHU is the temperature of the environment for the starter WUDQVIHUWKHGRXJKWRWKHëRXUHGFRXQWHUWRS)ROGWKH Loaves of sour dough just need their two slashes before going in the oven and for the breadmaking. Cool temperatures slow GRXJKLQKDOIWKHQKDOIDJDLQ)ODWWHQLWJHQWO\WKHQ things down. Warmer temperatures speed things up. repeat the folds. Return the dough to the bowl and let 7KHWLPHUHTXLUHGWRDOORZWKHEUHDGWRULVHWRLWVPD[ the dough rise again for one hour. imum varies widely, from a few hours to overnight. 2QFHDJDLQWXUQWKHGRXJKRXWRQWRWKHëRXUHGVXU 8VLQJDVFDOHZLOOUHVXOWLQPRUHDFFXUDF\RIPHDVXUH face. With a sharp knife slice the dough in half. Using ment as there is more precision when weighing the a gentle touch shape each half into a round. Cover LQJUHGLHQWVHVSHFLDOO\WKHëRXU these and let them rest for 20 minutes. I follow my son’s recommendation to allow the 3UHKHDWRYHQWRGHJUHHV),I\RXKDYHDEDNLQJ EUHDGWRULVHRYHUQLJKWZKHQ,PDNHP\êUVWÏUHDOÐ stone, place this in the oven to heat up. If you want VRXUGRXJKEDWFK7KHEUHDGWXUQVRXWêQHEXW,PLVV to use a Dutch oven, place this in the oven to heat up watching the progress. My second batch I start in the now. You can also use a baking sheet. morning and it is ready to bake by evening. M.D. of Wainwright No. 61 Riverdale Mini Park Spring Clean-Up Week Take notice that the Town of Wainwright Council, in the Province of May 11 - 17, 2020 Due to Covid 19 restrictions, Riverdale Mini-Park will only Alberta has given first reading to Bylaw 2020 – 05; which will, upon final reading and approval, authorize the Town to borrow money for the Town Council has declared the week of be opening to residents living within the M.D. of Wainwright purpose of financing operating expenditures. boundaries including the Town of Wainwright, Villages of May 11 to May 17 as Spring Clean-up Week. The rate of interest to be paid for the loan will be the Encompass Credit Irma, Edgerton and Chauvin at this time. Residents are encouraged to conduct their yard Union’s floating rate of prime lending minus 0.25%. Repayment terms clean up during the week of May 11 to May 17 and Riverdale Mini Park will be accepting bookings over the for the loan is interest calculated monthly and principal plus interest place sorted wastes such as tree branches, earth, phone only as of Monday May 11, 2020 and be open for payment monthly payable in full no later than December 31st of the said financial year. sod and grass clippings in clear plastic bags next to camping Friday May 15, 2020. their garbage containers for collection. The Public A copy of the bylaw may be viewed at the Town Officer located at 1018 Works Department will pick up these wastes from Please call the Riverdale Mini Park at 780-842-2996 for – 2 Avenue during normal business hours, or on the Town of Wainwright residential properties (excluding apartments) reservations during the following business hours: during the week of May 19-22. website at www.wainwright.ca. Monday May 11, 2020 9:00 a.m. – 12:00 p.m. Notice is hereby given by the Town of Wainwright Council that unless a The following items will not be petition of the electors for a vote on Bylaw 2020 – 05 is demanded as collected: refrigerators, deep freezers, Tuesday May 12, 2020 9:00 a.m. – 12:00 p.m. provided for by the terms of 231 of the Municipal Government Act, the air conditioners, microwaves, washers, Wednesday May 13, 2020 9:00 a.m. – 12:00 p.m. said Council may pass the said borrowing bylaw. dryers, dishwashers, stoves, hot Who can petition, number of petitioners required and the requirements water tanks, mattresses & box Thursday May 14, 2020 9:00 a.m. – 12:00 p.m. of the petition are described in Sections 222, 223 and 224 of the Munici- springs, carpets, paint cans, wet Regular clubhouse hours of 10:00 a.m. – 6:00 p.m. Monday – pal Government Act, a copy of which can be obtained online through cell batteries, construction the Queens Printer at www.qp.alberta.ca/documents/Acts/m26.pdf. material, furniture, automotive Sunday will commence May 15, 2020. parts and televisions. The 2nd and 3rd reading of Bylaw 2020 – 05 is scheduled for May 19, You will be responsible to follow all Alberta Health Services 2020. THANK YOU FOR YOUR guidelines and directions along with all M.D. of Wainwright COOPERATION. restrictions for opening. Dated at the Town of Wainwright, in the Province of Alberta this 6th day For further information contact of May, 2020. the Town of Wainwright For more information, please contact the M.D. of Wainwright Ed Chow at 780- 842-3381. $GPLQLVWUDWLRQRIÀFHDW Chief Administrative Officer EDGE | Wainwright, AB | May 8, 2020 5 OPINIONS Zak McLachlan Roger Holmesmes Aaron Holmeses Editor Road safety Emerging Forwards ay is Motorcycle Safety Awareness Month, and t has been a strange experience watching our on’t be in a hurry to go back to the way things Mthis is your annual reminder to keep an eye Icommunity shrink into itself almost to the van- Dwere. out for vehicles of all shapes and sizes on the roads ishing point. Stores closed. Main Street looking like Being in a hurry to “restart the economy” in a pan- this spring. a Sunday morning every day. Hockey no longer demic scenario is rather short-sighted. The economy A motorcycle-on-motorcycle collision at the inter- required. Eating establishments closed like a crocuse is transformed, not stopped. It’s more important that section of Highways 14 and 41 on Tuesday sent one in the evening. School yards vacant. Church parking we contain the spread of this disease than it is for us biker to hospital via STARS. Although the incident lots empty on Sunday morning. The people having to go shopping for things that aren’t essential. is very unfortunate and best wishes go out to those disappeared. If COVID-19 was a mugger who offered us a injured, it is a good reminder that motorcycles are It happened quickly. It happened silently. It was choice between our money and our life, we’d be back out on the roads and all motorists must be sure eerie like a movie about the end of time. People were bummed but we’d part with our money. to be extra cautious. just gone. Afterwards, we’d feel justified in grumbling about Alberta drivers have spent a long winter travel- This week things began to change. Slowly like our misfortune and try to figure out what we should ling the highways alongside nothing but large vehi- the arrival of spring a few more people appeared have done instead, but foregoing the money is still cles, so the emergence of motorcycles in early spring on the streets, in pairs at first cautious to avoid each the right call. is something we haven’t been used to over the past other, then on bicycles, then mothers pushing baby Here’s the paradoxical part about continuing many, many months. carriages, then whole families walking down the physical distancing. If we do it well, it feels like an Vehicles of all shapes and sizes with two, four or sidewalks, through the parks and on the green space overreaction and nothing happens. That’s still the 18 wheels all have the same right to the roads. It is trails in mild disbelief. Finally a gaggle of children point. It’s working, which is why it still feels like every motorist’s responsibility to take caution on the chase each other around the block without a parent overreacting. Have patience. Stay healthy. roads to ensure everybody’s safety. in sight. As for going back, we can do better than that. We After not seeing motorcycles on the roads since We are emerging. We know not how safe it is, we don’t want to go back to the way things were. Do you last fall, it can be easy to miss the small vehicles are dipping our toes in the water of life wondering want to go back to dialup internet? Black and White while doing mirror checks to change lanes, pass if it is going to bite us. We stand ready to pull back TV? Probably not. Those things are clearly worse vehicles or merge onto a highway. knowing a second wave could come crashing in on than what we have now. Now is the time to take an extra few seconds to us with little warning. This is where we cross the chasm between the check blind spots and ensure to check for motor- Our surroundings look familiar yet our habits way we used to be and what we’re becoming. That cycles and even cyclists for that matter. have changed. We are more cautious. We are start- act of our play is concluded. Bikers are much more exposed to danger than ing to wash our hands without being told. We It’s intermission. The next act in our story is being those inside an enclosed vehicle, so they should are not shocked to see people wearing homemade written. Going back to the way things were isn’t an certainly take extra precautions on the roads. And so masks. We can’t see if they are smiling but they option. We have these moments to choose a way should all other drivers. wave and we wave back. forward. Distracted driving is one of the most dangerous We are emerging with caution ready to retreat Let’s choose a story where we grow things, take practices on the roads, especially with motorcycles into the safety of our computers, our smart phones, care of each other, handle climate change, and have out and about. Looking down at your lap to send a our social distancing and our streaming movies a good time doing it. The other stories we could text message could be the difference between a relax- if the unseen danger of a microscopic enemy re- write, with the civic unrest and all that goes with ing Sunday drive and a life-altering incident. Please appears and threatens us again. it would make a fun TV series, but they wouldn’t be put the cell phones away while driving and be We are wise to be cautious. We are wise to be care- places we’d want to live. attentive to your surroundings while travelling this ful. The danger seems to be reduced but we know it spring and summer. People’s lives literally depend can come back with a vengeance if we fail to respect on it. the lessons learned by those who paid with their lives to teach us this, the lesson of our lives. Circulation 4,863 Published by 1027 - 3 Ave., Wainwright, AB T9W 1T6 Ph: 780-842-4465 Fax: 780-842-2760 website: www.starnews.ca Just Looking Around 2008 WINNER 2009 WINNER Roger Holmes Sherry Schatz Zak McLachlan Phyllis Holmes Everything is green again. Trees in If you are looking for a remote, Publisher Sales & Promotion Editor Projects [email protected] [email protected] [email protected] [email protected] the country side have burst out in almost unheard of, basic prairie one of our favorite colors. camping experience near a lake in **** the MD of Wainwright, see if you Gale Aykroyd Barb Tywoniuk Carrie Financial Accts & Graphics Baumgartner Town crews had 3 Ave. blocked off FDQêQG$PEOHU/DNH&DPSJURXQG Administrator [email protected] Graphic Design for the better part of the day this Hint, look north of Irma. Might be [email protected] [email protected] week while they carefully removed the best kept secret in the MD. The EDGE has 9,646 followers in print, i.e. 4,823 published with an average of two readers per printed copy. a large boulevard tree to make **** room for a driveway where some Kids out on roller blades going LETTERS POLICY: new homes have been constructed. down main street at Mach 2. The Wainwright EDGE welcomes letters to the editor **** **** for publication. Letters must be signed and a phone We've got you covered! number included so the writer’s identity can be verified. More people coming out of doors COVID-19 restrictions lifting a bit. The Wainwright EDGE reserves the right to edit letters this week as the temperature hit For better or worse? Don’t know. for legal considerations, taste, and brevity. plus 21 mid week. Almost felt like **** Please mail, e-mail, or drop off summer. If you need to get some service your comments to: **** on a cell phone Vince at Lakeland Letter to the Editor Farmers have full blown seeding Communications won’t unlock his 1027-3 Ave, Wainwright, AB T9W 1T6 Phone: (780) 842-4465 Fax: (780) 842-2760 operations underway. door, but he has this nifty slot cut in E-mail: [email protected] **** the wall by the door that you can The letters appearing in today’s paper have been edited Some of us are starting to get the pass your phone and credit card for length and other considerations. Please try to keep feeling that we are going to be in a through. Safe and creative. your letters under 300 words to ensure your Letter to the Editor appears as close to its original form as pos- Read The Wainwright EDGE E-Edition online weekly different world once this pandemic **** sible. Thank you to everyone who took the time to send at StarNews.ca And check us out daily on facebook is over. Call you mother on Sunday. us comments on the important issues of the day in our facebook.com/WainwrightStarNews community. Keep your input coming. FOR ALL YOUR ADVERTISING OPTIONS OR EVENT COVERAGE JVU[HJ[[OL,+.,'7O! -H_! ,THPS!PUMV'Z[HYUL^ZJH^^^Z[HYUL^ZJH (]L>HPU^YPNO[/V\YZ!4VUKH`;O\YZKH` !HT!-YPKH` !HT5VVU 6 EDGE | Wainwright, AB | May 8, 2020 20053DG2 Facebook Live Family Bingo gains large following Zak McLachlan [email protected] he Walker family of Wain- Twright started Facebook Live Family Bingo on March 27, as a way to combat the COVID-19 so- The Walker family in Wainwright has Facebook cial isolation boredom. At first, provided family, friends and people from Live video they expected to have a few fam- all over Western Canada with great fam- screenshot ily entertainment over the past six weeks ily members and friends get on with their weekly Facebook LIve Family board to stay entertained on Fri- Bingo. day nights, but they didn’t expect it to snowball as much as it did. family operation. Six weeks later, the Walkers have sent Scott is the face of the show, calling out 850 bingo cards and have nearly the game while wearing his humor- 600 people playing each Friday night. ous caps and t-shirts and dropping dad News of the quick growth in popular- jokes and bingo fun facts throughout ity of their weekly bingo nights recent- the night. His wife, Stacey, is the pro- ly reached CTV Saskatoon, who inter- ducer behind the scenes making sure viewed the Walker family on Tuesday. everything runs smoothly. His daugh- “COVID had just started, and we were ter, Peyton, announces the prizes and literally running out of things to do,” son, Carson, provides the entertain- said Scott Walker. ment by dancing during intermissions. As an avid hockey family, they were The bingo is free to play, and the excited for spring hockey, but the pan- Walkers have received tons of little demic put a stop to that. prizes from friends and family to give “So we just sort of got an old bingo out for bingo winners. machine and tried it on a Thursday “We appreciate all the support from night with two other friends and it everyone. It’s been great to hear the sto- went pretty well. So we ordered 100 ries of people playing along. People get cards, and by the next day we had to really excited when they get a bingo. It order more… People really enjoyed really puts a smile on our face because it. Week by week it just got bigger and people bought into it,” Walker said. bigger to where we’re at 850 cards now, Facebook Live Family Bingo has and any given week there’s about 500- been going strong for six weeks straight, 600 people playing.” but Walker said they are going to take Walker said they never expected their a little break to let themselves and the bingo nights to gain such a following. bingo players recharge after a number “We had no idea it would get this of exciting weeks in a row. big. We just thought it would sort of With the warm spring weather now be friends and family. We didn’t know here, bingo nights will run just a couple how fun, inclusive and interactive it nights a month instead of every week. would be,” he said. Walker said they will continue to They have had folks from Alberta, host the bingo nights until the COV- Saskatchewan, British Columbia and ID-19 pandemic is over in order to give even a family friend from Michigan their friends, family and new bingo playing on a weekly basis. Walker said friends a chance to socialize from a dis- about 40 different communities are rep- tance. resented on any given bingo night. EDGE The whole production is a complete Blurbs from the Battle River Lodge Submitted article Margaret Faas, Resident Club secretary n Monday, April 6, a wonder- Oful surprise appeared at our Martha Johnson Lounge win- dows. Two drummers and one highland bagpiper from the Battle River Pipes and Drums out of Sedge- we can do just the same. wick played wonderful Scottish tunes The guys are still enjoying the pool from outside that we all enjoyed. That table. There are exercises and games made our day for sure. Thank you so to keep everyone happy. The weather much fellows, from all of the residents. has made walking outside around the The residents would also like to Lodge quite pleasant. thank the office staff, activities, house- We would appreciate it if someone keeping, kitchen staff, maintenance would turn off the wind a bit and the crew and home care staff for taking sun would stay out more. Oh well, we such good care of us during this crazy are happy just to see that the snow has time the whole world is going through. gone and hopefully won’t return until A lot of things in the Lodge have been late in the fall. cancelled, but there are still things that We are well and we are blessed. EDGE | Wainwright,Wain AB | May 8, 2020 7 Sergeant Wes Bensmiller Constable Matthew Leblanc Corporal Norm Weber Constable Greg Bamber Corporal Kirk Smith Constable Charles Lambright Constable Ben Dixon Constable Lisa Harrower Constable Michael Hamilton Constable Jennie Reddick Constable Karanvir Nanuan Constable Mitch Gardipee POLICEBEAT “The Police Beat” is a joint effort be- One male was subsequently arrested 27th Street. Complainant advised who did not require police assistance. tween Star News and the Wainwright for being in possession of a stolen a small grey car was speeding and RCMP and is put together by a repre- vehicle. Male was later released on swerving all over the road. Members April 25 sentative of both organizations. court compelling documents. made patrols, but they could not lo- » 8:30 a.m. - Complaint of a landlord- April 20-26 » 8:10 p.m. - Complaint of a possible cate the vehicle. tenant issue at a residence in Wain- wright. Members made patrols and Zak McLachlan with files from break and enter to a lease site south- Sgt. Wes Bensmiller east of Chauvin. It is believed indi- April 23 mediated the incident. No further » viduals were attempting to steal a 1:50 p.m. - Complaint of a distur- police action was required. bance at a financial institution in There were 38 complaints/incidents, one truck, but no theft occurred. » 11:00 a.m. - Members received Wainwright. Customer refused to deer-related incident, no ‘not a police many complaints of a moose on the » 8:30 p.m. - Complaint of unknown leave after being denied service. matters’, no false 911 calls, no cases of loose in Wainwright. Members con- individuals stunting near the trestle Members made patrols and medicat- failure to appear and no false alarms were tacted Fish and Wildlife. Moose was bridge. No suspects at this time. Mem- ed the situation. Individual left the reported during the week. believed to leave town unharmed. bers made patrols, but they could not business without further incident. locate the suspects or their vehicles. » » 7:00 p.m. - Members on routine pa- 2:40 p.m. - Members conducted cur- trol observed a suspicious vehicle in April 20 few checks on an individual who was » 6:00 a.m. - Request to conduct a April 22 the parking lot of a business in Wain- » 7:30 a.m. - Complaint of a theft of ve- on numerous conditions to stay at a wright. Members later determined well-being check on a female who residence in Wainwright. Individual was believed to be in Wainwright. hicle from a business in Wainwright. the vehicle was unregistered and Vehicle was added to police database was not home. Members located the uninsured. Driver was issued a viola- Members determined the female was male, arrested him for breaching in Edmonton, and the information as stolen. No suspects at this time. tion ticket for no insurance. Vehicle conditions and later released him on was subsequently towed. was passed on to Edmonton Police » 10:00 a.m. - Complaint from a busi- court compelling documents. Service for follow-up. » ness in Wainwright of being de- » 11:30 p.m. - Complaint of a vehicle » frauded of $1,500 from an individual 4:30 p.m. - Members on routine pa- leaving a residence in Wainwright 8:00 a.m. - Complaint of a lock cut trol observed a suspicious vehicle in off complainant’s trailer at a business claiming to be sending PPE to the with numerous intoxicated individ- business. No suspects at this time. Wainwright. Vehicle was determined uals. Members made patrols and lo- in Wainwright sometime overnight. to have been stolen from the Vermil- Nothing appeared to be stolen. No Information forwarded to Canadian cated the vehicle. Driver was issued Anti-Fraud Centre. ion area. When members attempted a 72-hour license suspension. suspects. a traffic stop, the vehicle fled. Mem- » 9:00 a.m. - Complaint of an aban- » 4:00 p.m. - Complaint of suspicious bers did not initiate a pursuit. activity at a rural location south of April 26 doned vehicle in the ditch northeast » 6:00 p.m. - Request to conduct a » 4:50 p.m. - Complaint of a suspicious of Irma. Members made patrols and Edgerton. Unknown suspicious male was observed in a field. Individual well-being check on a female in male climbing through the window located the vehicle, which was de- Irma. Members located the female, of a vacant residence in Wainwright. termined not to be stolen. Registered was later identified as being from the Provost area. Provost RCMP were no- who did not require any police assis- Members made patrols and located owner was contacted and advised to tance. the male, who stated he was renting move the vehicle. tified for further follow-up. » 11:30 p.m. - Complaint of unknown the property but did not yet have a » 11:00 a.m. - Report of 15-20 bisons » 5:00 p.m. - Complaint of a theft of ve- key to get inside. Landlord was con- hicle which was parked at a business persons in complainant’s backyard on a range road near Edgerton. Own- looking around with a flashlight. tacted and confirmed that was the ers were located and contacted, who in Wainwright. Vehicle was added to truth. police database as stolen. No suspects Members made patrols in the area, advised they were in the process of » at this time. but they could not locate any suspi- 6:30 p.m. - Complaint of a possible rounding up the animals. cious individuals. stolen vehicle parked in Wainwright » 3:00 p.m. - Complaint of vandalizing » 8:30 p.m. - Complaint of suspicious with a number of occupants fighting of heavy equipment parked in a field individual believed to be in com- April 24 inside. Members made patrols and north of Chauvin. No suspects at this plainant’s neighbour’s back yard. » 3:00 a.m. - Complaint of a possible located the vehicle, which fled from time. Members made patrols, but they break and enter to a residence in the members. Vehicle was later located » could not locate the suspect. No other area of 6th Avenue and 6th Street. abandoned, with two individuals 5:30 p.m. - Members on routine pa- complaints received. trol on Airport Road observed a vehi- Members made patrols and deter- walking away from the area. Mem- cle exceeding the posted speed limit. » 8:30 p.m. - Complaint of a possible mined the individual was trying to bers were able to identify them as Traffic stop was initiated. Driver was intoxicated male and female laying get into a unit where a person was being inside the stolen vehicle. Male found to be operating a vehicle with on the ground in the area of 11th thought to be overdosing, but en- and female were arrested for pos- a suspended license. Driver was is- Avenue and 14th Street. Couple tered the wrong unit. Investigation session of a stolen vehicle and were sued a number of violation tickets. were observed yelling at each other. determined nobody as overdosing. later released on court compelling Members made patrols in the area, No emergency services attendance documents. April 21 but they could not locate the male required. » 8:30 a.m. - Complaint of a break in to and female. No other complaints re- » 4:00 p.m. - Complaint of graf- a trailer parked at a storage facility. A ceived. fiti spray painted on the wall at the sound bar was stolen from the trailer. » 10:30 p.m. - Complaint of individu- Wainwright library. No suspects or Stolen property added to police data- als drinking liquor inside a vehicle. witnesses at this time. Student of the Week base. No suspects at this time. Members made patrols and located » 4:40 p.m. - Complaint of lithium bat- Wainwright Elementary School, » the vehicle. Members determined the Student of the Week, 11:40 a.m. - Complainant advised a teries from a cordless drill turned in May 8, 2020 padlock was cut off a sea can at their passengers were consuming liquor to Wainwright Detachment, as they WES Student of the Week goes to out to all of our business in Wainwright. No suspects. inside the vehicle. Cannabis was also were thought to be stolen. Members within reach of the occupants. One of students at Wainwright Elementary. We would Nothing appeared to be stolen. could not determine the registered like to thank the students for working so well at the occupants was issued a $120 vio- » owner. home and keeping such a great connection with 3:30 p.m. - Complaint of a theft of lation ticket for open liquor. a vehicle parked at complainant’s » 6:40 p.m. - Request to conduct well- their teachers at the school. We know that this is a challenging time for our students, staff and business sometime overnight. Ve- » 11:30 a.m. - Complaint of a possible being check on a female in Wain- impaired driver on Highway 14 near parents and as Mr. Mitchell likes to say you all hicle was later recovered in Provost. wright. Members located the female, have been “Rock Stars”. Biker airlifted by STARS to hospital after two motorcycles collide at 14/41 intersection One man was airlifted to hospital by STARS Air Ambulance after two motorcycles collided at the intersection of Highways 14 and 41 at around 8 p.m. on Tuesday evening. Fire Chief Steve Douglas said it is believed one motorcycle travelling east on High- Sponsored By way 14 was slowing down to turn north onto Highway 41, when another motorcycle struck the first motorcycle from behind. The man airlifted by STARS sustained seri- ous injuries including head trauma, but Fire BUFFALO AGENCIES LTD. (780) 842-4357 Chief Douglas was unable to confirm wheth- er or not the injuries were life-threatening. Submitted photo 8 EDGE | Wainwright, AB | May 8, 2020 of twenty 45-gallon drums filled with The Wainwright Blessed Sacrament toxins. Church celebrated its 100th anniver- A packed Communiplex theatre sary over April 23-25th crowd took in the Sweet Adelines Tal- On May 1st the Wainwright Quota ent Showcase 2000 on Saturday night. Club hosted its annual Girls Night out Ken Morris is replacing Chuck Gagne with the theme, “A Night at the Mov- as the Manager of Lending at the Cred- ies”. The 254 tickets were sold out in Compiled by Phyllis Holmes from the newspaper archives twenty minutes for this annual event. [email protected] it Union. “History cannot give us a program The Knights of Columbus celebrated for the future, but it can give us a fuller April 26th as they changed the name understanding of ourselves, and of our of their council to the “Luke Killoran common humanity, so that we can bet- Council” in honour of the late Luke ter face the future” Robert Penn Warren Killoran, a charter member and father of John Killoran. Luke Killoran was One-Year remembered for his involvement Ten Years Ago in the building of the first Catholic Ago May 10, church in Wainwright, the convent May 7, 2019 and then the school. 2010 Forty Years Ago May 7, 1980 Carson Leggett had his team’s only Grade five students from Wainwright goal as the Bantam Wolfpack lose to Elementary School performed the Twenty Vermilion 10-1. operetta, “A Kid’s Life”. Throughout Years Ago the production the children learned The Town of Wainwright has signed from a wise pair of grandparents how May 9, on with the Trail of the Buffalo to 2000 to entertain themselves when their create a Destination Marketing Fund, electronics go down. On May 5th a motorcycle accident with the Town’s local campgrounds. claimed the life of the operator Mur- A one-dollar fee added to each camp- The Canadian Army’s training event, ray Neil, aged 27 years, of Chauvin, site will go towards the promotion of “Exercise Maple Resolve 19 began on Alberta. A passenger is hospitalized tourism in the area. Half will go to the May 6 and will run until May 25 with with a broken arm. Town of Wainwright to be put aside approximately 5500 soldiers partici- The Camp Wainwright Scout Troup Wainwright and area famers planted for future campsite improvements pating. cleaned up Wallace Park as their good 140 acres of Canadian Spring Wheat and the other half will go to the Trail The Council of the Town of Wain- deed in the “Outdoors Unlittered” in support of the Canadian Foodgrains of the Buffalo for the Destination Mar- wright and the Council of the M.D. of Pitch-In Clean Up Alberta ’75 cam- Bank in order to help feed the world’s keting Fund. Wainwright have agreed to continue paign. The Scouts included Shane hungry. The Town of Wainwright allocated joining forces to provide emergency Gessner, Brent Danielson, Jimmy Car- nearly $600,000 from last year’s sur- services to the Wainwright area. lin, Andrew Gagnon, Doyle Ziebarth, A hazardous waste round-up at the Wainwright Waste to Energy Facility plus into different departments for Gordon Bridgeman, Mike McRob, and future capital projects. Darrin Clark. resulted in 75 vehicle loads dropping Spring Is Here LET EVERYONE KNOW THAT YOU ARE TOO! Grab a pen or a computer and chronicle your COVID experience. It will be helpful for the future and it will also help us right now. We can help you communicate to people what your services are, your hours of operation, and what you THE EDGE are doing to keep your staff and customers safe. WOULD LIKE TO We are offering special rates and services to help you PUBLISH COVID get your message out. We have print copy and online viewership of over DIARY ENTRIES. 15,000 views per week. Please send yours to Call Sherry at 780-806-8401 or [email protected] email [email protected] EDGE | Wainwright, AB | May 8, 2020 9 Preparing for 2020 camping season The wood chips fly as Mel Hill runs a router to replace finish new seat for a picnic Handivan service begins table at Arm Lake on Wednes- day while Doug Lancaster holds the board and man- ager Lori Newman inspects to roll out once again the work pictured left. The crew were getting ready for the opening of the park on ear Editor, restart progresses. May 15. D We also require that each passenger wear a mask and that Pictured below, cat tails on The Wainwright and District there be only one passenger in the edge of Amblers Lake Handivan (WDHS) has been the van at any time. The driver north of Irma await visitors to significantly impacted by the will use a mask and gloves. The the recreation area starting outbreak of Covid 19. Our ser- van will be sanitized after each May 15. vice has been seriously restrict- use. Only one van will be used ed for the past weeks. With and the bus will not be used Photos: Roger Holmes the re-start of handivan service until further notice. we are following the require- Passengers can go from their ments of Alberta relaunch home to their destination with- strategy. Over and above these out any stops in between. The regulations we are implement- three seniors’ facilities have ing requirements specific to the guidelines in place for their res- WDHS van and driver. idents and we will abide with 1. As of May 4, we were able them. There will be no visiting to transport our clients to medi- between facilities at this time. cal services and dental clinics. We are here for you in these Individuals who live in their trying times. As always we are own homes can be transported committed to providing safe, for essential trips only such as reliable service to those per- grocery shopping. sons who need assistance. If 2. As of May 14, we will trans- you have any questions please port persons to retail businesses call or if you want to book a such as clothing stores Furni- ride call 587-281-9347. ture stores and bookstores. We will also transport people to personal services such as hair- Harry Loonen styling and barbershops. Chair, Wainwright and Dis- We are awaiting further trict Handivan Society guidelines from AHS as the Notes from MD meeting May 5 Roger Holmes He also outlined how property owned by the Depart- Opening of Parks [email protected] ment of National Defense in the MD is assessed. He MD operated parks will open May 15 see detailed noted the federal government does not pay taxes to story in the EDGE this week. he MD of Wainwright council held their annual the MD but makes a payment to the MD in leu of tax- Grazing Association request Tbudget meeting May 5th via computer and phone es in proportion to the land and property values. He The Cresthill Grazing Association requested permis- conference call. also encouraged councilors to direct any questions sion to install a dugout on land they use south and Property Assessment regarding individual assessments of property from east of Edgerton. They also noted they would need to Andre Guibault of Wainwright Assessment Group ratepayers that need detailed explanation to have the do some brushing around the dugout. Their request grave the council a detailed description of the method rate payer call him directly for more information. was approved with the notice that they must not do used to appraise the value of property in the MD. He The Budget the brushing until the bird nesting season is over. noted changes in the value of farm land, residential In a closed session the MD discussed the 2020 MD Office opening strategy and commercial buildings and recreational property budget. In open session they approved a budget of Administration will follow the provincial in the Municipality. He noted some valuations have $42,472,771. With no changes in the mill rates and government guidelines regarding safe practices at gone up and some have gone down depending a lot some changes in property values the MD expects to the MD office as required concerning the COVID-19 on information received from recent sales of property. raise $32,952,000 in taxes with the balance required pandemic. for the budget coming from grants. EDGE Thrillers Turn Your Backyard into your Summer Haven New Begonias Geraniums Trees & Shrubs We are Colors considered an essential New Vegetables & Herbs Grasses & succulents service Varieties Supertunias, crazytunias, easywaves in Spillers more than 25 different colors & Fillers Garden Seeds Onion Sets & much more! It’s time to bring your h Come in, look, make your selections or leave us your list It’s worth & arrange for curb side pickup at a later date. pots & baskets in! the drive in inings! savings!savav Les’ Greenhouse Phone: 780-842-2095 Family owned & Operated, Proudly Serving Wainwright & Area for 30yrs & Still Growing. 5 Miles east of Wainwright on Hwy 14 Hours: Mon. - Sat.: 10 a.m. - 7:30 p.m. Sun.: 1 p.m. - 6 p.m. Mon. - Sat.: 9a.m. - 10 a.m. Open for Seniors & immune compromised 10 EDGE | Wainwright, AB | May 8, 2020 THE EDGESPORTS Wainwright Golf Course opens for business for 2020 season Numerous mandatory health and safety restrictions in place Zak McLachlan [email protected] he Government of Alberta an- Tnounced late last week that golf courses around the province would be allowed to open on Monday, May 4, with a number of restrictions in place for the health and safety of golfers. Wainwright Golf Course was pre- pared and ready to open as soon as the provincial government gave the go ahead, and the first rounds of the year were played on Monday morning. Wainwright Golf Course general manager Jamie Hodge said she and her team are excited to see golfers coming out and supporting the local course af- Local golfers hit the links on Monday as the course opened for the first time on May 4. Golfers are required to follow a number Photo: Zak ter a long winter that was made even of restrictions, including mandatory physical distancing of six feet on the course. Pictured above, Mitch McLachlan tees off on hole McLachlan longer by the COVID-19 pandemic. 12 while his playing partners Jordan Leeming and Brad Bailey await their tee shot from a safe distance on the tee deck. “It’s amazing. It’s so nice to see people’s faces again. We’re just really excited to have a place for people to with the mental health aspect as As part of the COVID-19 restrictions, “Everybody has just been really ex- come where they can get outside, well as exercise and just give golfers a the course has spread out tee times cited and motivated, and everybody’s spend some time with their families chance to do the things they love.” 24 minutes apart to ensure social dis- been doing a good job of following the and hopefully help people’s mental The course has been busy over the tancing. rules. We just ask people for continued well-being,” Hodge said. first few days of the season, with tee Other restrictions include the club- support and patience as we navigate “We’re really happy we can help times nearly sold out. house and proshop remaining closed, through the next stages.” golfers must remain in their vehicles The course is in fantastic shape to until 15 minutes prior to their tee start the year, and that can be direct- time, only one individual is allowed ly attributed to the many volunteers to ride in a cart unless they come from who have put in countless hours to the same household, on course wash- prepare for the start of the season. rooms are closed and physical distanc- “One of our longtime members called ing of six feet is mandatory on the and said he’s never seen the course in course. this good of shape at this time of year. Another key restriction is the course There’s always work to do, but we’re will not allow walk-on golfers. Those really happy with how things are wishing to golf must book a tee time looking out there,” Hodge said. through the Chronogolf app, online at “We’ve had so many volunteers www.golfwainwright.com or by call- come out to help, and we’re so thank- ing the proshop. ful for it. We wouldn’t have been able Hodge said they will start opening to open without it.” up more tee times over the weekend, Early season tournaments have moving them to 16 minutes apart. been postponed, and the future of The driving range will also open this tournaments throughout the season is weekend. currently up in the air. “We’re managing well, so we’ll open All leagues are also currently post- up more tee times and the driving poned. Hodge said she hopes they can range will open Saturday. People have figure out an altered format which been respectful of the rules, and we’re would comply to the current restric- slowly getting things as far as the club- tions, but more information on that house and proshop ready. We don’t will be announced by the golf course Plenty of signage has been posted around the course to remind golfers of the Photo: Zak number of mandatory restrictions in place in order to utilize the golf course, includ- McLachlan know when it will be allowed to open, down the road. ing physical distancing, time restrictions and one person per power cart. but we’ll be ready,” she said. EDGE ATHLETE of the week ProudlyP Sponsored by Local golfers The Wainwright EDGE is pleased to announce all thee local avid golfers as this week’s Athletes of the Week. MOTORSS Golfers’ prayers have been answered, as golf courses 2110 - 15 Ave. Wainwright, AB T9W 1L2 around the area opened this week. Good luck out on the course, and please follow all the new rules and regula- 780-842-4471 tions when you tee off this spring. TOLL FREE 1-888-842-4471 Don’t be the guy who ruins it for everybody else. www.wainalta.com EDGE | Wainwright, AB | May 8, 2020 11 Hughenden Public School finds creative way to honour Class of 2020 Hughenden Public School found a great way to honour their Class of 2020 graduates. With the COVID-19 pandemic putting a hold on traditional graduation ceremonies, Submitted photos schools are coming up with fun ideas to celebrate their graduating students. At Hughenden Public School, staff have displayed a banner on the school sign and photos of all the graduating students on the lawn in front of the school. HPS teacher Cathy Samson said, “The staff here at Hughenden Public School wanted to do something to acknowledge their 12 years of hard work and the disappointment they were feeling at not being able to celebrate with friends and family.” Buffalo Trail Spring is here! Public Schools superintendent appointment expected in early June Roger Holmes [email protected] ue to the announce- Dment of the retirement of superin- to the new person in the superinten- tendent Bob Allen Buffalo Trail Public dent role. BTPS is very important to Schools board chair Lanie Parr told the Mr. Allen and he has assured us that if EDGE earlier this week that her board we need him to, he will help with the has made a recommendation to the transition for as long as required. The Minister of Education for the appoint- Board is very appreciative of Superin- ment of a new superintendent for the tendent Bob Allen’s commitment and school division. flexibility in these unprecedented She indicated they had numerous times.” applications for the position and she Allen is scheduled to retire August expects confirmation from the minis- 31, 2020, after serving as superinten- try by early June. dent for 11 years. Parr commented, “We are really EDGE Spring has sprung in Edgerton as the town announcement bale gets a Photo: Roger Holmes hoping for a very smooth transition new coat of paint; again. Are you tired of having to drive for hours to your vehicle’s dealership? IMPORT At Vic’s Service, we offer local, warranty approved, service SPECIALISTS and repair on all imported makes and models. Not only can we service your imported car, we can access, track, and manage all of your vehicle’s maintenance intervals and send you reminders on when these warranty required services are due. CALL CAROLINA TODAY 780-842-4172 KIA | TOYOTA | HONDA | HYUNDAI | MERCEDES | BMW | LAND ROVER | NISSAN | INFINITI | VOLKSWAGON 2YEAR (780) 842-4172 40,000KM or Book online at VICSSERVICE.CA Email: [email protected] Warranty 12 EDGE | Wainwright, AB | May 8, 2020 Grief in our changing world Submitted article are looking strange and un- toward someone, often our loved through the emotions the pain, will Walking Through Grief Society comfortable (the new nor- ones or family. If we don’t process still be there to be dealt with later. mal). the emotion in a healthy way it may Find a way to exercise. A walk, work- o matter if our world “New Normal” evokes be repressed, causing depression and ing out at your home, relaxing your Nconsists of our fam- emotions that range from isolating. mind and body with some mindful- ily, our community or on fear, anxiety, anger, help- The suggestion is to talk through the ness breathing or yoga and listening a much larger scale, other lessness, confusion and feelings. In this time of uncertainty to calming music playing music, art or countries, when there is a deep sadness and depres- and social isolation it is more difficult journaling. life change, our lives are sion. We are not used to to reach out and find that safe person Lastly, spend a little time each day impacted in many different coping with that many you are comfortable talking to. You to find a gratitude and a positive ways. We are seeing this emotions, often several at may feel overwhelmed and have a thought and find an “Accountability with the pandemic and ef- a time. The result of hav- sense of helplessness, but sharing Buddy” to share with. Write the grati- fects it is having on us and ing different and often new with someone helps give perspective. tude on your calendar. The brain is the world around us. emotions can cause dis- Talking with that person, a counsellor affected in a positive healing way by In a death loss or a life loss, the im- tress, not knowing how to deal with or a support worker is vital. doing this activity. pact of normalcy has changed and the emotions and having coping skills Make sure you are doing self care: May you see each new day as the affects us. We are thrown into trying of survival. adequate sleep, food, and hydration. first day of the rest of your lives. The to hang onto what was normal, struc- When faced with change, we expe- Reducing alcohol consumption and challenge is how will you spend it? tured and predictable, and now facing rience fear and anxiousness which drugs, though it eases the pain for the We still have choices even when we nothing normal to cling to and things can result in anger being expressed present without coping and working are faced with “New Normals”. Make them good choices. Playgrounds to remain closed even after campgrounds in the M.D. reopen later this month Playgrounds will remain closed. This play- ground at Salt Lake, pictured above, and the one at the Fabyan Campsite, pictured right, will not be open when the campgrounds within the M.D. of Wainwright open on May 15th. Photo: Roger Holmes WƌŽƉŽƐĞĚĞZĞƐĞƌǀĞϮĂƚƚĞƌLJ^ƚŽƌĂŐĞWƌŽũĞĐƚ sŝƌƚƵĂůŽŵŵƵŶŝƚLJKƉĞŶ,ŽƵƐĞ;KŶůŝŶĞŽƌdĞůĞƉŚŽŶĞͿ tĞĚŶĞƐĚĂLJ͕DĂLJϭϯƚŚ͕ϮϬϮϬʹϲ͗ϬϬWDƚŽϴ͗ϬϬWD dZ/WŽǁĞƌ>ƚĚ͘ŝƐƉƌŽƉŽƐŝŶŐƚŽĐŽŶƐƚƌƵĐƚƚŚĞĞZĞƐĞƌǀĞϮĂƚƚĞƌLJ^ƚŽƌĂŐĞWƌŽũĞĐƚĂƉƉƌŽdžŝŵĂƚĞůLJƚǁĞŶƚLJ ŬŝůŽŵĞƚĞƌƐŶŽƌƚŚŽĨƚŚĞsŝůůĂŐĞŽĨ/ƌŵĂ͘dŚĞĨĂĐŝůŝƚLJǁŝůůĐŽŶƐŝƐƚŽĨĂϮϬͲDĞŐĂǁĂƚƚ;DtͿĐĂƉĂĐŝƚLJůŝƚŚŝƵŵͲŝŽŶ ďĂƚƚĞƌLJƐƚŽƌĂŐĞƐLJƐƚĞŵ͕ůŽĐĂƚĞĚĂƚƚŚĞ^ͲϭϭͲϰϴͲϬϵͲtϰDƐƵƌĨĂĐĞůŽĐĂƚŝŽŶ͘ dŚĞƉƌŽƉŽŶĞŶƚƐĂƌĞƐĞĞŬŝŶŐŝŶƉƵƚŽŶƚŚĞƉƌŽƉŽƐĞĚƉƌŽũĞĐƚĨƌŽŵŝŶƚĞƌĞƐƚĞĚƐƚĂŬĞŚŽůĚĞƌƐ͘'ŝǀĞŶƚŚĞĐƵƌƌĞŶƚ Ks/ͲϭϵƐŝƚƵĂƚŝŽŶ͕ǁĞĂƌĞĨŽůůŽǁŝŶŐƚŚĞůďĞƌƚĂhƚŝůŝƚŝĞƐŽŵŵŝƐƐŝŽŶ͛ƐŐƵŝĚĞůŝŶĞƐŽŶƐŽĐŝĂůĚŝƐƚĂŶĐŝŶŐƚŽ ĞŶƐƵƌĞƉƌŽƉĞƌĐŽŶƐƵůƚĂƚŝŽŶ͘tĞŝŶǀŝƚĞLJŽƵƚŽũŽŝŶŽƵƌsŝƌƚƵĂůŽŵŵƵŶŝƚLJKƉĞŶ,ŽƵƐĞƐĞƐƐŝŽŶ͘ ZĞŐŝƐƚĞƌĂƚ͗ MUNICIPAL DISTRICT OF ŚƚƚƉƐ͗ͬͬĞƌĞƐĞƌǀĞͲƉƌŽũĞĐƚ͘ĐŽŵͬĞƌĞƐĞƌǀĞϮͲŽƉĞŶͲŚŽƵƐĞ Read The ƐĂŶĂůƚĞƌŶĂƚŝǀĞ͕ƚŽƌĞƋƵĞƐƚĂĐŽƉLJŽĨƚŚĞĞZĞƐĞƌǀĞϮƉƌŽũĞĐƚŝŶĨŽƌŵĂƚŝŽŶƉĂĐŬĂŐĞďLJŵĂŝůŽƌĞŵĂŝů͕ŽƌƚŽ WAINWRIGHT NO. 61 ƐĐŚĞĚƵůĞĂƚĞůĞƉŚŽŶĞĐŽŶƐƵůƚĂƚŝŽŶǁŝƚŚĂdZ/ƉƌŽũĞĐƚƌĞƉƌĞƐĞŶƚĂƚŝǀĞ͕ƉůĞĂƐĞĐŽŶƚĂĐƚ Wainwright ŝŶĨŽΛƚĞƌŝĐƉŽǁĞƌ͘ĐŽŵŽƌĐĂůůϰϬϯͲϲϲϬͲϱϮϯϲ͘ NOTICE Schedule “A” tĞďƐŝƚĞ͗ŚƚƚƉƐ͗ͬͬĞƌĞƐĞƌǀĞͲƉƌŽũĞĐƚ͘ĐŽŵͬĞƌĞƐĞƌǀĞϮ The Municipal District of Wainwright No. 61 proposes to amend its Land Use Bylaw No. 1318, as amended to May 15, 2007, by amending E-Edition the land use from Agricultural District to Country Residential District located in the NW 6-44-6 W4M containing approximately 10 acres online weekly at as shown in Schedule A. A Public Hearing will be held by the M. D. of Wainwright at 10:30AM, May 19th, 2020. In order to ensure StarNews.ca Farm, Oilfield, Commercial, Residential staff safety due to the COVID-19 pandemic, persons claiming to be affected by this change may send their concerns by means of written And check us WE SPECIALIZE IN: Vegetation control/property management; submission only. Submissions may be sent by fax, email or mail to out daily on Fence line Cleanup, mulching and maintenance; Exterior Painting the following: facebook on large buildings (barns, outbuildings corrals & more); Light to Fax: 780-842-2463 Email: [email protected] Mail: 717 – 14 Ave. Wainwright, AB T9W 1B3 facebook.com/ heavy equipment washing Attention: Kim Christensen Wainwright- EQUIPMENT: Various size tractors & rough cut mowers; Skid Written submissions must be received by May 18th, 2020 at 4:30 pm in order to be considered at the public hearing. Copies of the StarNews steer (w/mulcher attachment); 50ft man basket; Steam truck proposed amending Bylaw 1659, and Land Use Bylaw No. 1318, as amended to May 15, 2007, may be requested by contacting the De- Call for your free estimate velopment Officer. Office: 780-842-2067 Email: [email protected] Kim Christensen Danny Mitchell 780-209-4430 Jamie Mitchell 780-209-4433 DEVELOPMENT OFFICER an EDGE 4-pack EDGE | Wainwright, AB | May 8, 2020 13 The ONLY $350 Business&ProfessionalDirectory FOR 3 MONTHS! CALL 780-842-4465 TODAY $872027,9( YOUR AD HERE 6(59,&( 5(3$,5 ONLY $117/MNTH FOR 3 MONTHS! <#,0'4+,(.'4 <1&-165 (37,&( 1B5: &;C1> " CALL < (4,'(05,$.&857,6&8551//(3&,$..$44 SHERRY TODAY <1630(:/$0$YH:DLQZULJKW$%.$;(310 5$)) ->91881 5/718 " %XV+RXUV0RQ)ULSP 780.842.4465 XT] UT%@>11@w)-5:C>534@ 8.1>@-w&])U ] &9,3$1'2872)3529,1&(,163(&7,216 "4;:1 I[\TJ\XV WYTUw-D I[\TJ\XV ZVU[ FEED GRAINS YOUR AD HERE WANTED ONLY $117/MNTH Sunhaven Farms Milling, Irma, AB FOR 3 MONTHS! We are looking to purchase Feed Grains: Wheat, Peas, Fabas, Barley. CALL For all your corral cleaning and spreading call: We offer competitive pricing and prompt payment. SHERRY TODAY )% #% For more information and pricing, please contact: Cell: (780) 842-7812 George Gross 780.842.4465 Ted Ratte, Manager Cell: 780-806-9245 Phone: 780-754-2708 Fax: 780-754-2709 #&$' e-mail: [email protected] VETERINARY MEDICAL CENTER #20 2902-15Ave Wainwright (Across from McDonald’s) 3HW/DVHU6XUJHU\ 3 +/:.$+$6'+(3: 3HW/DVHU7KHUDS\ +RXU <1/2.(5(",4,10:(($.5+9$/4<105$&5(04(4 *HQHUDO0HGLFLQH +HDOWK6HUYLFHV 6HUYLFH < $)(5:.$44(4<(4,*0(3:(8($3< 60*.$44(4 +HDOWK6HUYLFHV FRQVXOWDWLRQ +10( IRUODUJHDQLPDOV 34103,$/ 2/ $9 Dr. David Weeks 780-845-8838 2(0$5(!+6345,. 2/ /$,.,0)1(:(4,05180&$ Dr. Hannah Poulin 5#$,083,*+5!# #(%4,5(888(:(4,05180&$ YOUR AD HERE ϮϮϬϮͲϭǀĞ͘tĂŝŶǁƌŝŐŚƚ OILFIELD & GENERAL CONSTRUCTION ONLY /MNTH SITE SERVICES WE REPAIR & SERVICE: $117 14+<106#.+4'%6+10#.4+..+0)X :%#8#6+10X #7.+0) ͻůůƵƚŽŵŽƟǀĞďƌĂŶĚƐͻs/W FOR 3 MONTHS! %%'55#66+0)h#.'5n'06#.5 ͻ,ĞĂǀLJĚƵƚLJŵĞĐŚĂŶŝĐĂůŶĞĞĚƐ +4'7224'55+100+65 ͻKŶƌŽĂĚĂŶĚKīƌŽĂĚŚĞĂǀLJĞƋƵŝƉŵĞŶƚ CALL LOCATIONS:Tg#+094+)*6X'#%'+8'4X 4#0&' SHERRY TODAY 4#+4+'X 4#0&'#%*'g:$19 ƌŽĚLJ'ŝůĐŚƵŬ ,ŽƵƌƐ͗ :Ğī<ĞŶĚƌŝĐŬ 780.842.4465 n U 780-806-9972 DŽŶͲ&ƌŝ͕ 780-806-6890 1'#<.';hKLNgLHFgNLKF ϳĂŵͲϱƉŵ 14#0+'. 1&)'KLNgLHFgMHEI )LQGLQJWKHULJKW DQVZHUVWDUWV NICKERSON ROBERTS here Barristers & Solicitors Providing Full Legal & Real Estate Services Approved Relocation Lawyers NEW Ownership | New Menu “Successful Terry B. Roberts, Q.C. people are not NEW Competitive Prices gifted, they just work hard, then succeed NEW HDTV’s - Sports Bar Atmosphere 608 – 10 St. Wainwright AB T9W 1E2 on purpose.” G.K. Nielson 780-842-6185 780-703-1979 | Hwy 14 Wainwright 711 - 10th St, Wainwright 780.842.4171 ZZZGOLSFFD BATT PJs Bookkeeping LE R IVE R D. J.D. BARBER Bookkeeping for small business. ELECTRIC LT EQUIPMENT LTD. Ř&5$UHPLWV ŘSHUVRQDOWD[UHWXUQVDQGUHDVRQDEOHUDWHV ELECTRICAL / VOICE & DATA dā3+,) /34#J/'-#Y-30 ,-d / *!!4-3!/4 *!/'##*, /4- -/'-3 Ř\UVH[SHULHQFH Serving Wainwright & Area Since 1974 >=C@[=@0-/ !53 ("4 Unit 1, 2002, 15th Avenue Wainwright Wainwright (780) 842-4485 email: [email protected] 780.842.5711 Provost (780) 704-0596 Ph: 780-842-3271 Cell: 506-754-5062 *3''*+3Ă-/07 +47ā3+,) Mon. 12 - 8pm | Tues. 8 am - 6 pm | Wed. 8 am - 2 pm www.battleriverelectric.com /34#J-30 ,-Y-%/ 3T 14 EDGE | Wainwright, AB | May 8, 2020 I finally hear from the dermatologist’s office and I have an appointment in a couple weeks. I had started wondering if I needed to call, but decided to wait just a little longer. I will go in for a biopsy on April 15th. They outlined all the pro- cesses for me to follow to keep myself and them virus free. I need to come in on my Covid Diary own, have my temperature taken, sani- tize my hands when I get there, keep my distance. I am counting on Roger to take me. I don’t want to do this on my own, not even driving to the city. One of my cousins who has been liv- Grab a pen or a computer and chronicle your COVID experience. ing in Camrose dies and there will only be one cousin and his wife, the funeral The Edge would like to publish your COVID Diary entries. Please send yours to [email protected] director and a minister at the graveside service. It is still so cold today (April 2nd)). be overwhelmed. I am horrified by what It is -23 on and I send my thoughts out to The New Normal we see on the news in other countries, these few representing our large family with hospitals and the medical staff over- at the historic Bethany church near Don- whelmed. We must avoid that here. alda where my ancestors settled back in By Phyllis Holmes ing. It takes me a while to sort out where I hope the Americans have clued the early 1900’s. It feels so cold and lonely [email protected] the mistake is. And it turns out that there Trump in that sending troops to the Ca- as I think about it. is more than one mistake. I have ripping nadian border is ridiculous and scary! Roger is going to buy some coffee to- to do. My expert quilter of a sister tells I have to see a dermatologist. After pro- day. It seems like one is risking one’s life History professor, Catherine O’Donnell me, “Unfortunately ripping out is part of crastinating for too long I have finally to go shopping - or perhaps someone tells us that keeping a diary of our experi- quilting”. seen a local doctor and now need to go else’s. I feel guilty because I didn’t have ences during the Pandemic could help fu- I have another problem. I know what I to Edmonton. I have some spots that coffee on my shopping list when I went ture historians. “In a moment like this, the have to do for the next few steps, sewing need to be looked at. With the virus fall last time. I was very careful about put- need to gather people’s experiences of the the strips together, but I have misplaced out ramping up each day, addressing this ting down all the things I was aware we pandemic, however mundane they are, is the pattern. Somewhere between our important.”. O’Donnell explains that with- non-COVID health concern seems petty, needed, but I don’t fill the coffee grinder, out the stories of ordinary people we will quilting get together at the beginning but I had started this process before all Roger does and so that stays off my radar. end up with “an archive that is hopeless- of March and unpacking all the quilt- this happened. It takes a while to get in Since he is going anyway, he is going to ly slanted toward the famous” . The Edge ing things back at my house I can’t find to see a doctor. And anyway, it would see if there is some lamb we can have for would like to publish COVID Diary entries the pattern. I look and I look and I look have been embarrassing to survive a Easter. It doesn’t seem to make sense for from people of all ages. Please send yours again. I need the pattern to know how global pandemic that may well affect me to cook a turkey or a big ham when to me at [email protected] to cut the border and the binding, how 70% of the people living in the world and we are on our own. i would still like Eas- to cut the backing. I feel stupid. As well ter to be special. Turkeys are on sale right It is the second week of March and the then die of a treatable skin cancer! Some- the pattern was my sister’s. I have been a now and I am tempted, but I still have realities of living in a world where a Pan- one from the dermatologist’s office calls poor steward of it. leftover turkey in the freezer from Christ- demic is raging hit home for me. me and asks if I can take photos of these Roger writes about a “new normal” mas! And when we have lamb, Roger have been working on this “Shadow spots and send them to their office. I can in his editorial. I don’t like this term. I likes to do the cooking. Maybe I can have Box” quilt I started making at my sister’s do this and rope Roger into taking the don’t like the idea of a world that has to a night off. before the world shut down. The quilt is close ups. He drags me over to a window be so isolating, where we need to go out I write an email to my sister in Calgary. for my oldest granddaughter and is the for the better light. It is easy to send these in masks, where we approach people on I tell her I am feeling a little gloomy and second one I have made. The first one I photos from my phone to my computer the street tentatively, having to work out that it seems like I need to have coffee made went to a grandson who was mov- and then email them all to the address I a way to pass each other safely. I don’t and a chat with someone. It helps when ing from his crib to a bed. The quilt for my have been given. I ask if they will please like that I need to avoid people in the she writes back to me. grandson was made in blues and greens let me know that they get the photos and grocery store and how in true Canadian Another sister has started making and cream colours that remind me of this that they are acceptable. I hear back that fashion I hear fellow shoppers apologize, masks, just in case. I am skeptical. I am grandson’s home on Gabriola Island. This they have the photos and am relieved I “Sorry” when they know we are passing on side with Dr. Tam who is suggesting second quilt is made of the pinks and don’t have to go all the way to the city too closely. this is not necessary. I see people fiddling purples, mauves and pale blue that my and back just to have someone look at I read that there is a 70% chance of get- with the masks, letting them hang below oldest granddaughter likes. the spots and then tell me I need to come ting the virus in Canada; so the chances their noses or around their chins. I agree I have switched around some of the back for x, y or z. Perhaps there will be are that a lot of us will get it. I under- that they could give a false sense of secu- panels and have sewn them on the more remote medicine going forward - stand as well that if too many of us get rity. wrong way. The quilt pattern isn’t work- and that might be a good thing to come it all at once the health care system will out of all this. bas c’est que j’ai une jeu pour occuper ton person who leaves our property. Covid Diary Submission temps. Imagine que tu es un garde de sé- The reason I put a diamond here is curité dans un musée et tu dois garder le because I have a game to occupy diamant en sécurité. your time. Imagine aller au parc avec ma famille. Je pense Translation: that you are a secu- By Amelia Holmes que je suis très chanceuse d’avoir un pe- Grade 3 French Immersion Ahh, my life right now, they aren’t the rity guard in a mu- Airdrie, Alberta tit terrain de jeux dans mon arrière-cour. best days! I can normally go to the play- seum and you have Ma mère est plutôt la seule personne qui ground with my family. I think I’m very to keep the diamond Ahh ma vie en ce moment, c’est pas les sort dehors notre propriété. lucky to have a little play structure in my safe. meilleurs jours! Je peux normalement Le raison que j’ai mis un diamant la backyard. My mom is usually the only Grab a pen or a computer and chronicle your COVID experience. BLESSED SACRAMENT CATHOLIC CHURCH GRACE UNITED CHURCH ST. THOMAS ANGLICAN CHURCH 906 - 6th7(06(< 5+7(06(< 5+!53((5< Saturday 5:00 p.m Mass, $/#134+,2+(.',05+(!$0&56$3: $/#134+,2!60'$:!&+11. It will be helpful for the future !60'$: $/$44 (71-8$', "$4(.( (700$3,(,&-.,0 email: $2145.(55(.640(5 and it will also help us right now. CANADIAN MARTYRS’ CHAPEL (CATHOLIC) JEHOVAH’S WITNESS CONGREGATION 6,.',0* <#$,083,*+5 7(06(< WAINWRIGHT PENTECOSTAL ASSEMBLY Sunday 9:00 a.m. $/#134+,2 5+7(06(< $/!60'$:!&+11. $,5+1//60,5:113',0$513 PEACE LUTHERAN CHURCH $/2/#134+,2 30510:#(360*$ 5+7(06(< THE EDGE WOULD LIKE TO (95 $/#134+,2!60'$:!&+11. 2/10#('0(4'$: ,%.(!56':,';10( CHURCH OF THE NAZARENE $4513' 145( PUBLISH COVID DIARY ENTRIES. $45134$06':$3&+6- $/'6.5!60'$:!&+11. LORD OF THE NATIONS FULL GOSPEL CHURCH $/#134+,2 !53((5< CHURCH OF JESUS CHRIST OF LATTER DAY SAINTS 5+7(06(< !(37,&(!60'$:!&+11.'63,0*#134+,2 !(37,&(4$5 $/ 2/ !(37,&()13$..$*(4 $4513 :$0#11' $/#134+,2 ST. PAUL’S CHAPEL (PROTESTANT) THE GOSPEL EVANGELICAL FREE CHURCH 6,.',0* <#$,083,*+5 $.. <!60'$: 2/ 5+7(06(< !60'$: $/ #$.5(363-,04+$8 $/130,0*#134+,2!(37,&( $,5+1//60,5:113',0$513 $33(."630(3 !(0,13 $4513$37,0 (00(3 (7(05134/$0 Please send yours to (95 [email protected] ALL PUBLIC CHURCH SERVICES DURING COVID 19 ISOLATION ARE SUSPENDED UNTIL FURTHER NOTICE EDGE | Wainwright, AB | May 8, 2020 15 Classified ads get results! To place a classified ad by, call (780) 842-4465 CLASSIFIEDS email [email protected] or visit our website at www.starnews.ca. We take credit card payments by phone for your convenience. FOR RENT EMPLOYMENT ROSE compliments of CALL 780-842-4465 or ',))(5(17 5 & *5$17 email [email protected] %8,/',1*61RZ +ROGLQJV/WGRD Rose Wainwright CLASSIFIEDS GET RESULTS 6HFXULW\ &DPHUDV 7LP+RUWRQV to you Flower Cart IRU\RXUSURWHFWLRQ ,V FXUUHQWO\ ORRN I AM RESEARCHING THE HISTORY %DFKHORU $SWV LQJIRU)RRG6HU 6-;/,)(9@̜9(5*/ 6WDUWLQJ DW YLFH6XSHUYLVRUV Tiffany, Addyson Classifieds 6PDOO%HG /RFDWLRQ & Jaxon also known as the McPherson & Quigley Ranch URRP$SWV6WDUWLQJ WK $YHQXH For for painting my window at located nine miles north of Wainwright. Ads Get $OOXWLOLW :DLQZULJKW $% Battle River Lodge. In 1917-18 they built a hip roof barn 44 ft. by 84 ft. Results LHV LQFOXGHG LQ 7: $ and a complete set of ranch buildings. If you have Whether you’re buying or selling ERWK HYHQ SRZHU 7HUPVRI(PSOR\ any information, stories, pictures or memories of DQGFDEOH&ORVHWR PHQW 3HUPDQHQW To place classified ad’s If you know someone +RVSLWDO&DOO )XOO WLPH 3DUW the ranch or area I would like to hear from you. who deserves Call 7LPH'D\(YHQ Contact Allen Ford at 780-842-3609 or 780-842-4465 recognition, LQJ1LJKW:HHN [email protected] or email [email protected] call The EDGE at: $9$,/$%/(,0 HQG 6KLIW 0RUQ 780-842-4465 0(',$7/< LQJ(DUO\0RUQLQJ %HGURRP WRZQ 6DODU\KRXU KRXVH %HQHILWV PRQWKSOXV 6WDUW'DWH$6$3 Notice of Application EMPLOYMENT SRZHUDQGGDPDJH ([SHULHQFH\HDU Confined Feeding Operation GHSRVLW LQFOXGHV WROHVVWKDQ\HDUV JDVDQGZDWHU &DOO (GXFDWLRQ1RGH The Village of Irma The Hutterian Brethren Church of Ribstone has filed application RA20012 with the Natural JUHHFHUWLILFDWHRU Resources Conservation Board (NRCB) to obtain an approval to expand the dairy portion of an already existing confined feeding operation (CFO) on the E1/2 8-42-3 W4M and W1/2 9-42-3 CHIEF ADMINISTRATIVE OFFICER GLSORPD W4M in the MD of Wainwright of Alberta. The application is to permit facilities that were 3OHDVHFRQWDFWIRU constructed without a permit (three dairy pens and two calf barns), to construct a new dairy barn FULL-TIME EMPLOYMENT and a liquid manure storage. The application is also to increase the number of permitted dairy MREGHVFULSWLRQ livestock to 250 milking cows, including associated dry cows and replacements, and to reduce the Situated in East Central Alberta, the growing Village of Irma appeals to all with its outstand- +RZWR$SSO\ amount of feeder cattle on site from 3,500 to 2,000. ing location, family-orientated environment, excellent recreation facilities and numerous The NRCB will also determine the grandfathered status of the CFO. The NRCB invites you to services. Located 175 kilometers southeast of Edmonton and 30 kilometers northwest ,Q3HUVRQRUPDLO SURYLGHLQSXWRQWKH&)2ҋVOLYHVWRFNW\SHOLYHVWRFNFDSDFLW\DQGIDFLOLWLHVDVWKH\H[LVWHGRQRU of Wainwright, the Irma community members and visitors enjoy the 9-hole golf course, around January 1, 2002. The Hutterian Brethren Church of Ribstone has stated that its $WDERYHORFDWLRQ grandfathered livestock capacity is 130 milking cows, 3,500 feeder cattle, 24,000 broiler chickens, hockey arena and outdoor rink, curling rink, ball diamonds, newly constructed K-12 school, %\HPDLO 1,000 ducks, 200 geese, 200 laying chickens and 200 turkeys. and service clubs, all within the safety and heart of the beautiful rolling parkland of the Battle River Country. Additional amenities are offered a short distance away in the close ZDLQWLPV#JPDLO community of Wainwright. Filing a Statement FRP Any person who is directly affected by the application and the determination of grandfathered status 7KH9LOODJHRI,UPDLVVHHNLQJDIXOOWLPH&KLHI$GPLQLVWUDWLYH2IƓFHUWRSURYLGHFRPSUH- %\ ID[ may submit a statement of concern to the NRCB. The statement of concern must be received by hensive advice to its Council on all aspects of municipal governance and legislative re- the NRCB on or before June 8, 2020. Submissions must be made to the NRCB email address quirements, to ensure the direction of Council is implemented, and to provide effective provided below. A copy of the statement of concern will be sent to the applicant for review and comment. Statements submitted regarding the application are public records and are non- leadership to the whole organization and community. LIVESTOCK confidential. The selected candidate will be responsible for preparing, monitoring, and reporting on Your statement of concern should include your name, the legal land description of your residence WKHDQQXDOƓQDQFLDOSODQ7KHLQFXPEHQWZLOOXQGHUVWDQGWKHORFDOJRYHUQPHQWQHHGV or landholdings, mailing address, phone number, email address, and a detailed summary that and challenges of small rural communities, enjoys coordinating information and making describes how you would be directly affected by this application. For further information please refer decisions, and takes an interest in global issues that affect us all. The ideal candidate will to the fact sheet “The Permitting Process for Confined Feeding Operations in Alberta” at EHSURƓFLHQWLQYDULRXVFRPSXWHUVRIWZDUHDSSOLFDWLRQVLQFOXGLQJ:RUG([FHOƓQDQFLDO www.nrcb.ca. You may also file an application for directly affected party status at this time. accounting software (Muniware), etc. Failure to submit a statement of concern may affect your rights to apply for an NRCB review. Ideally, the successful candidate will possess strong technical skills in municipal admin- LVWUDWLRQDQGƓQDQFLDOPDQDJHPHQW([FHOOHQWFRPPXQLFDWLRQDQDO\WLFDODQGOHDGHUVKLS Viewing the Application skills are just some of the requirements of the position. Desired candidates would normal- A complete copy of the application and supporting documents submitted by the applicant under the O\UHTXLUHWKHFRPSOHWLRQRIDFHUWLƓFDWHLQ/RFDO*RYHUQPHQW$GPLQLVWUDWLRQRUHTXLYDOHQW Agricultural Operation Practices Act may be viewed only on the NRCB website at www.nrcb.ca (under Confined Feeding Operations / Applications & Decisions / Notice of Applications) until June training and experience. 8, 2020. Until further notice, the application will not be available for in-person viewing as the Red 7KH9LOODJHRI,UPDRIIHUVDFRPSHWLWLYHFRPSHQVDWLRQDQGEHQHƓWVSDFNDJHDQGFRQWLQX- Deer office of the NRCB is closed to the public due to COVID-19. If you require further information, please contact the approval officer listed below. ous learning opportunities in a community that enables a superior work-life balance. For more information about the community, please visit our website at www.irma.ca and see if this opportunity suits your lifestyle and career goals. Jeff Froese, Approval Officer The closing date for submissions: June 8, 2020 ,QWHUHVWHGFDQGLGDWHVDUHLQYLWHGWRVXEPLWWKHLUDSSOLFDWLRQLQFRQƓGHQFHE\ [email protected] 4:00 P.M. T 403-340-5795 Dated at Red Deer AB, on May 8, 2020 May 29, 2020 to: Village of Irma “CONFIDENTIAL” www.nrcb.ca Box 419, Irma, Alberta T0B 2H0 $WWHQWLRQ-RDQ*UHHQ0D\RU(PDLOMJUHHQ#LUPDFDD Classifieds phone: 780-842-4465 (102) We thank all applicants for interest expressed in this competition however only candidates who most Classifieds email: [email protected] FORVHO\ƓWRXUQHHGVZLOOEHFRQWDFWHGIRULQWHUYLHZV AW NA These blanket classified ads are produced through a joint agreement with The Wainwright EDGE and Alberta Weekly Newspaper Association (AWNA). These ads appear in all AWNA member papers (111 BlanketClassifieds papers) for the cost of $269.00 for the first 25 words, $8.00 per word over 25. To place a blanket classified, call The Wainwright EDGE at 780-842-4465. AUCTIONS JOURNALISTS, GRAPHIC HEATED CANOLA buying WD[ FUHGLW DQG OXPS message out about changing cesslegalmjf.com. Power and Natural Gas and TUCKER ACREAGE ON- ARTISTS, Marketing and Green, Heated or Springth- sum refund. Take advantage of operations, cancellations, etc. EARN/MAKE MONEY on much more. For more info: LINE AUCTION May 7-13, more. Alberta’s weekly news- rashed Canola. Buying: oats, this offer. Apply NOW; quick- Though we cannot guarantee your Internet, Home Phone, PDULR#JPDULRQDUGHOOLFRP MAS Sales Centre, Black- papers are looking for people barley, wheat & peas for feed. est refund Nationwide: Expert publication, AWNA will get falds, AB. Compact Tractors, like you. Post your resume on- Buying damaged or offgrade help. 1-844-453-5372. this information into 3 PT Acreage Equipment, line. FREE. Visit http://awna. grain. “On Farm Pickup” REAL ESTATE the right hands for com/resumes_add. Westcan Feed & Grain, 1-877- 21/<SOXV*67 Skid Steer Attachments, RV’s, SASKATCHEWAN FARM- Motorhomes, ATV’s, Cars, ONLY EXPERIENCED AS- 250-5252. (PDLO FODVVLÀHGV# /$1' RQ %DNNHQ 2LOÀHOG awna.com for details. To everyone in rural Alberta, Trucks, Enclosed & Equip- PHALT PAVING Personnel FOR SALE 8QGHU DQ DFUH 3D\LQJ ment Trailers, Harley Da- required for in-Edmonton BEAUTIFUL SPRUCE 5% return with long term CRIMINAL RE- thank you for all you do to keep vidson Motorbike, JD Zero work. Call 780-466-7763. 75((6·DYHUDJH2QO\ lease. For more information, CORD? Why suffer your community spirit alive. Turn Mower, Posts & Lumber, FEED AND SEED Quality guaranteed. Machine contact Doug at 306-716- employment/licens- Livestock Equipment, Hi-Hog SODQWLQJ RQO\ ,QFOXGHV 2671. ing loss? Travel/busi- Buffalo Squeeze, Tarp Build- CERTIFIED SEED. Wheat ness opportunities? - Go Early, Pintail, AAC Pen- Wurzel Dip root enzyme SERVICES We are thankful for those in the ings, Work Benches, Tools & and bark mulch application. Be embarrassed? Misc. www.montgomeryauc- hold. Oats - AC Morgan, AC REQUIRE PRESS RELEASE Think: Criminal Par- transportation and food industry; to Mustang, Derby, SO1 Super Minimum order 20. Deliv- tions.com 1-800-371-6963. HU\FKDUJHRUGHU SERVICE? Let us help you don. US entry waiv- Oat. Barley - Busby, Cerveza, with that! During this unprec- er. Record purge. those who keep the power on, the COMING EVENTS CDC Austenson, CDC Mav- Crystal Springs. 403-820- 0961. edented time, we are assist- File destruction. Free energy flowing, and the utilities SAVE THE DATE!!! 100 erick, Sundre. Very Early Yel- ing organizations, businesses consultation. 1-800- Years of Friends, Family and low Pea. Forage Peas. Polish JOHN DEERE 310D Trac- and the public in getting their 347-2540. www.ac- working around the clock; and to Fellowship. Eckville Home- Canola. Spring Triticale. mas- tor Loader coming 2021. July 1-4, 2021. tinseeds.com. 403-556-2609. Backhoe. our farmers and ranchers, who Stay tuned for more details. EARLY VARIETIES. Want to 4-wheel drive. continue to work hard with calving EMPLOYMENT EHÀQLVKHGFRPELQLQJLQ$X Extenda hoe. OPPORTUNITIES gust? Go Early HRS Wheat, First owner. Tired of Reseeding your Alfalfa? and preparing for seeding. Busby & Sundre Barley, AAC &DOO BLANKET THE PROVINCE 780-446-1051. ZLWKDFODVVLÀHGDG2QO\ Peace River Field Peas (earli- For Sale Certified Algonquin Alfalfa Seed Together we will make it through est yellow pea). Early One HEALTH (based on 25 words or less). 99.9% purity, zero weed seeds, Inoculated, in 55 lb bags this. May you, your family and your Reach 90 weekly newspapers. Polish Canola (one month ear- HIP/KNEE Call NOW for details. 1-800- lier); mastinseeds.com. 403- REPLACE- Wholesale price $3.00 a pound. Algonquin Alfalfa is a tap root tri-foliate, community stay healthy. 282-6903 Ext 4; www.awna. 556-2609. MENT. Other extremely winter hardy, fine stem, with excellent disease resistance. com. FORAGE SEED FOR medical condi- Farmer Direct, we grow what we sell. – Linda Humphreys, Interim Chair SALE: Organic & conven- tions causing Rural Health Professions Action Plan (RhPAP) CIVIC NEWS REPORTER FREE SHIPPING ALBERTA-WIDE on orders over 2200 lbs. required for small community tional: Sweet Clover, Alfalfa, TROUBLE weekly in Alberta to start im- Red Clover, Smooth Brome, WALKING or Now Selling Brome, Orchard & Wheat Grasses PHGLDWHO\ IRU RQH Meadow Brome, Crested DRESSING? year term. Please send resume Wheatgrass, Timothy, etc. Star The Disabil- RAM RIVER FORAGE SEEDS and writing samples to: clas- City, SK. Birch Rose Acres ity Tax Credit www.rhpap.ca VLÀHGV#DZQDFRP Ltd. 306-921-9942. allows for Call 403-330-9136 ramriverforageseeds.ca \HDUO\ 16 EDGE | Wainwright, AB | May 8, 2020 Travel Los Livingroom to Puerto This May Long Backyardia with Weekend a stop at... SALE MAY 8 TO 21, 2020 Bud, Bud light 95 or Kokanee $69 48pk cans Works out to $34.98 per 24pk cans Pilsner or 95 Lucky Lager $54 48pk Cans Sleeman $2995 Clear 2.0 BONUS Original Draught 24pk cans Canadian, 95 BAG OF ICE Coors Light $36 or Coors Original 24 pk cans Miller 95 High Life $18 15pk Cans American Vintage 95 Keystone 95 Barely Sweet Mixer $19 Lager or $19 12 pk cans Light 15pk cans Twisted Tea 95 Original, Half & Palm Bay Iced Half 12 pk Cans $20 95 Tea Variety Pack $18 12 pk cans White Claw 95 Blk Cherry, $10 Mango, Lime, Ruby Grapefruit 6pk Cans Smirnoff Ice 95 Nutrl Vodka 95 Arizona Hard Grapefruit, $10 Soda Mixer 95 Green Apple, Lemonade, Lime, $18 Pack 12pk cans Green Tea $11 Orange Scredriver, Peach 6 pk cans Bellini, Pineapple 6 pk cans Alberta Royal Silent Grey Bacardi Captain Premium Rye Reserve Sam Goose Reserva Morgan Pure Vodka 1.14L Vodka Vodka Limitada Spiced Rum 1.75L Plastic 750ml 1.75L 750ml 1.14L $3995 $2695 $1795 $8495 $4495 $3295 New Gray Monk Amsterdam Blarney’s Latitude 50 Bombay Kahlua Pink Irish Cream Canada Gin 750ml Whitney 1.14L 750ml 750ml Red, White 750ml 95 95 95 $2295 $1195 $24 $21 $23 Black Cellar 1884 Layer Cake Copper Moon Apothic Canada Argentina Australia Canada 750ml US 750ml Cabernet Sauvignon, 3L 750ml 750ml Red Chardonnay, Malbec, Malbec Malbec Shiraz Merlot, Pinot Grigio, Merlot Rose, Sauvignon 95 $8 $1295 $1395 Blanc, Shiraz $2695 $695 PLUS MANY MORE IN-STORE SPECIALS Ř6WUHHW:DLQZULJKW VISIT US ON WAINWRIGHT CHAMBER OF COMMERCE HOURS: “Your Community Minded Liquor Store” Locally Owned & Operated BUSINESS OF THE YEAR 2010 MON. - SAT. 10:00 am - 10:00 pm Please don’t drink and drive /wainwrightliquor by Jay & Sandra Robinson 2007 Alberta Retailer of The Year SUN. 11:00 am - 7:00 pm