OXSR1 Monoclonal Antibody (M16), Clone 3A8

Produktinformation

Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien

Weitere Information auf den folgenden Seiten! See the following pages for more information!

Lieferung & Zahlungsart

Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic OXSR1 monoclonal antibody (M16), clone 3A8

Catalog # : H00009943-M16 規格 : [ 100 ug ] List All

Specification Application Image

Product Mouse monoclonal antibody raised against a full length recombinant Western Blot (Cell lysate) Description: OXSR1.

Immunogen: OXSR1 (AAH08726.1, 1 a.a. ~ 527 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence: MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLE KCQTSMDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSV enlarge LDIIKHIVAKGEHKSGVLDESTIATILREVLEGLEYLHKNGQIHRDVKAGNILL Western Blot (Cell lysate) GEDGSVQIADFGVSAFLATGGDITRNKVRKTFVGTPCWMAPEVMEQVR GYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQ DKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQKAKNKEFLQ EKTLQRAPTISERAKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEE GKAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIA TQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDIR FEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIVEEPQSNRSVTF KLASGVEGSDIPDDGKLIGFAQLSIS enlarge

Host: Mouse Western Blot (Cell lysate)

Reactivity: Human, Mouse, Rat

Isotype: IgG2a Kappa

Quality Control Antibody Reactive Against Recombinant Protein. enlarge Testing: Western Blot (Cell lysate)

enlarge

Western Blot (Recombinant protein)

Immunohistochemistry Western Blot detection against Immunogen (83.71 KDa) . (Formalin/PFA-fixed paraffin- embedded sections) Storage Buffer: In 1x PBS, pH 7.4

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction:

MSDS: Download enlarge Datasheet: Download Immunofluorescence

Applications Western Blot (Cell lysate)

Page 1 of 4 2016/5/22 enlarge

Sandwich ELISA (Recombinant protein)

OXSR1 monoclonal antibody (M16), clone 3A8. Western Blot analysis of OXSR1 expression in PC-12 ( Cat # L012V1 ). Protocol Download enlarge Western Blot (Cell lysate) ELISA

OXSR1 monoclonal antibody (M16), clone 3A8 Western Blot analysis of OXSR1 expression in Hela S3 NE ( Cat # L013V3 ). Protocol Download

Western Blot (Cell lysate)

OXSR1 monoclonal antibody (M16), clone 3A8. Western Blot analysis of OXSR1 expression in Raw 264.7 ( Cat # L024V1 ). Protocol Download

Western Blot (Cell lysate)

OXSR1 monoclonal antibody (M16), clone 3A8. Western Blot analysis of OXSR1 expression in NIH/3T3 ( Cat # L018V1 ). Page 2 of 4 2016/5/22 Protocol Download

Western Blot (Recombinant protein) Protocol Download

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

enlarge this image Immunoperoxidase of monoclonal antibody to OXSR1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] Protocol Download

Immunofluorescence

enlarge this image Immunofluorescence of monoclonal antibody to OXSR1 on HeLa cell. [antibody concentration 30 ug/ml] Protocol Download

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged OXSR1 is approximately 0.03ng/ml as a capture antibody. Protocol Download

ELISA

Gene Information

Entrez GeneID: 9943

GeneBank BC008726.1 Accession#:

Protein AAH08726.1 Accession#:

Page 3 of 4 2016/5/22 Gene Name: OXSR1

Gene Alias: KIAA1101,OSR1

Gene oxidative-stress responsive 1 Description:

Omim ID: 604046

Gene Ontology: Hyperlink

Gene Summary: The product of this gene belongs to the Ser/Thr protein kinase family of proteins. It regulates downstream kinases in response to environmental stress, and may play a role in regulating the actin cytoskeleton. [provided by RefSeq

Other - Designations:

Page 4 of 4 2016/5/22