Aviva Systems Biology C6orf182 antibody - middle region (ARP55720_P050) Product Number ARP55720_P050 Product Page http://www.avivasysbio.com/c6orf182-antibody-middle-region-arp55720-p050.html Product Name C6orf182 antibody - middle region (ARP55720_P050) Size 100 ul Gene Symbol CEP57L1 Alias Symbols MGC21731, MGC70837, bA487F23.2, cep57R, C6orf182 Protein Size (# AA) 460 amino acids Molecular Weight 54kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 285753 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Centrosomal protein 57kDa-like 1 Name Description This is a rabbit polyclonal antibody against C6orf182. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: LNVEREKNMILEQQAQLQREKEQDQMKLYAKLEKLDVLEKECFRLTTTQK Description of The exact functions of C6orf182 remain unknown. Target Protein Interactions KLC4; LZTS2; FAM161A; KATNAL1; CEP44; TSGA10; CEP70; CEP63; MYO15B; CCDC102B; LENG1; CCDC136; CARD9; RINT1; TRIM54; LMO3; CEP55; ROPN1; TRAPPC2L; TFIP11; NUP62; MTUS2; MID2; MORF4L1; GADD45G; IKZF1; CALCOCO2; HGS; AP1M1; KRT38; TRIP6; TRAF2; TCEB3; SNAPC3 Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 6-8 weeks delivery International: 6-8 weeks *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges Blocking Peptide For anti-CEP57L1 (ARP55720_P050) antibody is Catalog # AAP55720 (Previous Catalog # AAPP36427) Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C6orf182
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Complete Anti-C6orf182 (ARP55720_P050) computational species homology data Tissue Tool Find tissues and cell lines supported by DNA array analysis to express C6orf182. Swissprot Id Q8IYX8 Protein Name Centrosomal protein CEP57L1 Protein Accession NP_776191 # Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express C6orf182. Nucleotide NM_173830 Accession # Conjugation ARP55720_P050-FITC Conjugated Options ARP55720_P050-HRP Conjugated ARP55720_P050-Biotin Conjugated Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast Application WB Predicted Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Homology Based Rabbit: 93%; Rat: 100%; Yeast: 83% on Immunogen Sequence
Image 1: Human Jurkat WB Suggested Anti-C6orf182 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate
AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2