Celtic Bosses Drop the Ball Best Man for the Job Now Seems to Be a Woman MORGAN PIEK Staff Feeling the Pinch As It Has Become a Asking Price

THURSDAY 9 AUGUST 2018 NEWS YOU CAN USE FREE Kaalvoetkjint se hart lê in Gatvol. . .

Annicy Brussel (47), ’n tandartsassistent van Johannesburg, het Maandag haar boek Kaalvoetkjint van Keimoes, wat handel oor haar grootwordjare, aan haar ma, Sherene Brussel (71), in die Gatvol-plakkerskamp in Heidedal oorhandig. Tydens die geleentheid was van links Sherene Brussel, Johan Jansen van Vuuren (projekbestuurder van die FAK), Marthinus (Tienie) Brussel, Annicy Brussel, Carl (Tienie) Theunissen (draaiboekskrywer, regisseur en joernalis) en Seugnet van Zyl, (kommunikasiebeampte van die FAK). Lees die volledige berig op bl.2. FOTO: PIERCE VAN HEERDEN Celtic bosses drop the ball Best man for the job now seems to be a woman MORGAN PIEK staff feeling the pinch as it has become a asking price. Considering the club’s financial bonds. [email protected] monthly occurrence where they do not receive trouble, an extra R8 million in the bank account These units in the northern suburbs were their full salaries, or in some cases some have would have been smart business. included in the original package when The Premier Soccer League, Bloemfontein been paid and others not. As it is, Tshabalala last week applied for Tshabalala put the club on the market. Celtic, is set to be under new ownership by the Tshabalala indicated that he was putting the sequestration due to the financial troubles. He The sale of Bloemfontein Celtic is practically end of this week. This will bring to an end the club up for sale and this has led to an outcry has put several of his properties up for sale a done deal, however, the matter is in the Max Tshabalala era, which has been a rocky by the Siwelele faithful. This was due to an in order to generate funds to pay off debt and hands of the PSL at the moment. Leshabane affair since he bought the club from Jimmy unnamed Kimberley businessman who was play the players’ salaries. has confirmed that the entire deal is pending Augousti in 2014. linked with buying the club. The supporters What is unclear at this stage, is whether or the final approval by the league, and she is Bloemfontein Courant has been of the club were rioting, as they were led to not Leshabane and her said-to-be business only willing to comment on the matter once the reliably informed that the Bloemfontein believe that he wanted to relocate the club to partner, Dr Moeketsi Mosola, have agreed to transaction has been completed. businesswoman and current owner of the ABC the Northern Cape. purchase the six townhouses in Park Avenue, Should Leshabane take over the club on Motsepe League, Sinki Leshabane, will sign It is true that there was interest from Jan Wilkens Street, which the club owns. Friday, she will have to solve the wage crises a contract for the purchase of the financially Kimberley, however, relocating the team was Tshabalala purchased the properties in order to as soon as possible, and also secure a main embattled Celtic on Friday. not entirely true. The potential buyer wanted accommodate numerous of his players. sponsor for the team. There is a sports betting The financial trouble at Celtic has been well half of the team’s home games in the PSL Standard Bank has approached the High company which has expressed its interest, documented over the past few months, and to be played in Kimberley, for which he was Court in Bloemfontein to recuperate the some however, that in it’s own is a delicate matter this has also led to the players and coaching prepared pay an extra R1 million on top of the R4 million owned by the club on the property and is also in the hands of the league. 2 COMMUNITY NEWS • GEMEENSKAPSNUUS www.bloemfonteincourant.co.za • [email protected] • 9 August 2018 ‘Kaalvoetkjint’ se verhaal roer PIERCE VAN HEERDEN [email protected]

’n Doodgewone gesprek met ’n vreemdeling oor haar kinderjare in die Noord-Kaapse dorpie Keimoes, sou Annicy Brussel (47) ’n tandartsassistent van Johannesburg, nooit kon laat dink dat sy op 40 ’n boek sou skryf wat haar lewe sou verander nie. Carl (Tienie) Theunissen, navorser en regisseur, het dié interessante tandartsassistent toevallig in ’n tandarts se spreekkamer ontmoet. Vyf jaar later oorhandig Brussel haar boek oor haar grootwordjare aan haar moeder in die Gatvol- plakkerskamp in Bloemfontein. ’n Emosionele Sherene Brussel (71) troos haar Toe ’n emosionele Brussel op Maandag 6 dogter Annicy Brussels omdat sy haar trane nie Deric Style (Bloemfontein Mag Repairs), Dries Bentley, Joy Bentley en Daniel Joubert (Bloemfontein Augustus boek, Kaalvoetkjint van Keimoes, kon terughou terwyl sy haar storie vertel nie. Mag Repairs) FOTO: PIERCE VAN HEERDEN aan haar ma, Sherene Brussel (71), FOTO: PIERCE VAN HEERDEN oorhandig, het sy gesê, “Vir ons was dit net om skool klaar te maak en om vir Mamma en met haar geloof, ankers bly. Waar onthou Dedda te help. Ek kon hulle trots maak met bewaar word, spookbeelde werklikheid kan Twee se vinnige dinge wat ek graag wou doen vir hulle in my wees. Waar kontraste nie keuses afdwing pa se afwesigheid. Ek lewe nog steeds vir my nie, maar insig skep.” ma en ek sal vir haar lewe tot die dag dat sy Die publikasie van die boek het met nie meer daar is nie, want alles kom terug – die welkome betrokkenheid van die FAK optrede red bejaarde moontlik geword. Johan Jansen van Vuuren, ek ploeg terug in wat hulle in my gesaai het.” Volgens ’n resensie geskryf deur prof. projekbestuurder van die FAK, beskryf PIERCE VAN HEERDEN Toe hulle buite Bloemfontein Mag Repairs Christo van Rensburg, is hierdie ’n heerlike Brussel se boek as ’n storie wat lesers op [email protected] in Mackenziestraat stop, het Joy vinnig ongekunstelde verhaal. “Die verhaal van ’n nederige reis neem. “Die wonderlike gaan water vra omdat Dries nie in staat meer as haar reis. Nie net na die groot stad verhaal van Brussel neem lesers op ’n Wat vir Dries Bentley (64) en sy vrou, Joy was om te loop nie. Hy het erge pyn in toe nie. Die groot reis van volwasse word lewensveranderende reis. Van geloof, Bentley (73) van Brandfort, soos ’n gewone daardie stadium ervaar. Deric Style en en van aanpas, van riethuis tot steenhuis, na kerk op Sondae, van skoolbanke van dag begin het, was vir Dries op die ou einde Daniel Joubert, eienaars van Bloemfontein en van paaie waarop haar voete nou anders Maandae tot Vrydae, tot partytjies op ’n dag waarop hy by die dood omgedraai Mag Repairs, het vinnig gereageer en kom loop omdat die ou weë ook verander het. Die Saterdae waar daar lekker geskoffel is.” het. help. Hulle het met Dries na Mediclinic reis na die vervloë tyd is ook haar binnereis. Kaalvoetkjint is ’n reis in die verlede, van Op besoek aan die Rosestad op 17 Bloemfontein gejaag waar hy opgeneem Sy bevestig weer die bande met die ankers ’n Afrikaanse vrou na haar wêreld van gister. Julie, het hulle ’n draai by Bloemfontein is vir vyf dae. Na verskeie toetse en van haar kleintyd, waar Ma en Antie en Die skryf-gogga het Brussel behoorlik gebyt Mag Repairs gemaak en ’n stukkende wiel skanderings is bevind dat Dries net betyds Dedda meer word as net woorde, en saam en sy is tans besig met haar tweede boek. daar gelaat om reggemaak te word terwyl hulp gekry het. ’n Virus het blykbaar sy hulle solank inkopies gaan doen het. Dit oorkanaal binnegedring en ’n toestand was toe dat Dries begin naar voel het en veroorsaak wat sy balans geaffekteer het. asof sy balans versteur was. Hy vertel, “Ek Volgens die Bentleys kon dit baie erger het aan my vrou gesê ek voel nie goed nie uitgedraai het as dit nie vir die vinnige FS will be No.1 ons is terug kar toe. Ek het ’n slukkie water optrede van die personeel en eienaars geneem en toe ek beter begin voel het, van Bloemfontein Mag Repairs was nie. besluit om terug te gaan na Bloemfontein “Bloemfontein het regtig goeie mense. again – Tate Mag Repairs en daar te wag.” Op pad Ek wil graag dankie sê aan almal by PIERCE VAN HEERDEN daarheen was Dries en sy vrou byna in ’n Bloemfontein Mag Repairs en Mediclinic [email protected] ongeluk betrokke en hy het besef dat sy Bloemfontein vir hul uitstekende diens en simptome vererger. hulp,” het Dries gesê. “When the national education department announces the results again in January next year, the Free State will be number one again.” This is according to Free State Department of Education MEC, Tate Makgoe, after honouring outgoing and welcoming the newly elected School Governing Bodies (SGBs) on Saturday, 4 August 2018.The Free State Premier, Sefora Sisi Ntombela, and ceremony was held at University of the Free Free State Department of Education MEC, Tate State (South Campus) with the purpose of Makgoe. PHOTO: PIERCE VAN HEERDEN thanking members of the outgoing SGBs for their selfless service to the course of was the premier of the Free State, Sefora education and welcoming 18000 newly Sisi Ntombela, who spoke about the key elected SGB members who came into office points. “I’m here to support and encourage in April 2018. the department and the SGBs, to assure According to Makgoe, SGBs have power them they are working hand in hand with the in terms of the law and exercising that power department. Parents are involved in their is what is important and in the interest of children’s education,” Ntombela said. children. The newly elected SGBs will also Makgoe said that there is a lot of work that be the first to receive incentives. “This is needs to be done at primary school level. the first time that the SGBs will be receiving The department also wants to introduce incentives because we have left them out incentives for those SGBs that will be doing and we think it was a mistake, Makgoe said. well and are giving a hundred percent. “We The vision of the Free State Government, have been giving incentives to principals, the expectation of the executive council, the teachers and not the SGBs. We say in this vision of the Department of Education and tripod of education, we want to include what the departments would like to achieve, the SGBs as the parents are very crucial were some of the key points that were in the education of the children,” Makgoe discussed and outlined. Among the guests concluded.

SONAR | CIRCUMCISION SMALL PROCEDURES Listen to your Heart BLOOD PRESSURE SUGAR|DIABETES PREGNANCIES HIV|AIDS we’ll take CARE of the REST. MB.Ch.B (UOVS) MEDICAL AID & CASH CONSULTATIONS T: 051 430 5100 Middestad Centre First Floor Medical Suite 6 |Bloemfontein

Editor - Pieter Delport SALES STUDIO AUDIT REPORT NEWS: [email protected] Corni Fourie - 082 780 7272 The distribution of this ABC Community Specialist - Seithati Semenokane Marelize Dunlop - 082 291 4124 Elmarie Venter newspaper is independently  082 3701 268 [email protected] Mitzi Noome - 082 575 0571 audited to the professional General Manager - Christel Basson Tarryn Swartz - 071 762 7535 Liezl Magson standards administrated  051 5050 900 [email protected] Judy Barnard - 076 791 0304 Moloko Moholwa by the  [email protected] Sales Manager - Corni Fourie Tumo Moabi - 071 456 2267 Felecia Wessels - 051 5050 926 Audit Bureau of Central Media Park. Distribution Supervisor - Nicodemus Mokapane (Classifieds) Orefile Malebo Circulations of South Africa. 7 Christo Groenewald street. This newspaper is obligated to report news truthfully, accurately and fairly. All rights and reproduction material published in this newspaper are hereby reserved in terms of the Copyright Act. This publication is registered as a newspaper. Verified distribution: 50 000 copies per week. Wild Olive Estate. Bloemfontein. 9301. For any complaints about our distribution, please contact Andries Kleinhans on 084-610-8337 or send an email to: [email protected] 9 August 2018 • [email protected] • www.bloemfonteincourant.co.za COMMUNITY NEWS • GEMEENSKAPSNUUS 3 Ekspo vir jong wetenskaplikes skop af

JERETHA OOSTHUIZEN [email protected]

Dit is weer tyd vir al die slimkopskoliere om bymekaar te kom vir die Eskom-ekspo vir jong wetenskaplikes. Hierdie ekspo gee aan graad 5- tot 12-leerders die geleentheid om hul projekte oor hul eie wetenskaplike ondersoeke en bevindings aan ander te wys. Steven Sacht-Luwes van die Vanjaar gaan 226 leerders Jordan-Beth Erlank skilder sowat drie weke Hoërskool Voortrekker in Bethlehem aan ’n kunswerk – mits sy daarmee tevrede is aan die ekspo deelneem, met ’n tydens verlede jaar se ekspo waar FOTO: PIERCE VAN HEERDEN totaal van 197 projekte bestaande hy as die algehele wenner in die uit 22 katogorieë, wat strek van provinsie aangewys is, lanbouwetenskappe, chemie, ingenieurswese en meer, terwyl 72 vrywillige beoordelaars die 22 buiteland te studeer, geld Jong kunstenaar betower kategorieë sal beoordeel. Uit die en ander opwindende pryse groep sal 17 leerders gekies word ingesluit. om aan die nasionale ekspo, wat Die beste ekspo-projekte met haar kuns van 2-5 Oktober 2018 in Boksburg is nie altyd ingewikkeld nie, plaasvind, deel te neem. maar verbeeldingryk en goed JERETHA OOSTHUIZEN Wanneer Erlank Deur aan die ekspo deel te uitgevoer. ’n Goeie ekspo- [email protected] skilder, probeer sy neem, kry leerders die geleentheid projek is dikwels ’n slim altyd om haar werk om hul wetenskaplike bewustheid oplossing vir ’n probleem, Vroue uit die Bybel, kinders van in iets positiefs te te verhoog, hul kennis op te skerp ’n nuwe benadering of Afrika en die effek van water is net ’n verander, al kon die en hul wetenskaplike horisonne te metodologie vir ’n bestaande paar van die temas wat die 17-jarige afkoms moontlik verbreed. oplossing, ’n insig tot sosiale Jordan-Beth Erlank met haar hartseer gewees Jaarliks word 35 leerders by gedrag en ’n innovasie besonderse kunstalent aanpak. het. “Met my kuns die streek-ekspo gekies om met entrepreneuriese Erlank, wat tuisonderrig ontvang, bevorder ek ook aan die Eskom-Ekspo vir jong moontlikhede. skilder reeds vandat sy kan onthou. graag vroue en wetenskaplikes se internasionale Die streek-ekspo vir “Ek was so drie jaar oud. Dit is hoe kinders.” wetenskaplike uitstalling deel te jong wetenskaplikes vind ek met my ouers kommunikeer het. Sy het natuurlik naam. Daar neem leerders van vandeesweek plaas. In kruidenierswinkels sou ek met ’n gunstelingwerk, regoor die land sowel as ander Die verrigtinge begin op my asem teen die yskaste se deure en dit is dié van die Potloodkuns is een van Jordan se gunsteling-mediums. dele van die wêreld aan die Donderdag 9 Augustus en duur blaas en in die gewasemde deel sou Afrika-kind wat sy FOTO: PIERCE VAN HEERDEN kompetisie deel. tot Saterdag 11 Augustus 2018 ek ’n prentjie teken van wat ek wou geskilder het. “Dit Verlede jaar se pryse het beurse in die Callie Human-saal by die hê. Ek sou ook met modder op die voel vir my soos my of Bread. om in die land sowel as in die Universiteit van die Vrystaat. een kant van die kar teken terwyl my eie klein sussie,” sê sy. In haar vrye tyd doen sy graag pa die ander kant van die kar was,” Van haar sketse is uiters joga. Sy is ook mal oor musiek, veral sê Erlank. besonders en lyk kompleet soos ’n Broadway-musiek. Sy vertel ook hoe sy destyds vir foto wat geneem is, beslis nie soos Haar droom? “Ek wil my eie een kunsklas gegaan het en, is baie iets wat deur ’n tiener geskilder is kunsgalery in New York besit.” duidelik daaroor dat sy niks daarvan nie. Volg gerus dié kunstenaar op gehou het nie. Sy het gevoel die Erlank het haar kuns op die sosiale media. Jy gerus ook Jordan WINTER kunsonderwyser wou sy manier van Vrystaat Kunstefees uitgestal en daar Beth Art and Design op Facebook PROMOSIE dinge doen op haar afdruk. is van haar kuns is te siene in House besoek. Young GRATIS artists wanted Many talented young RAAM people responded to the invitation tot Bloemfontein R1500 Courant published Bepalings en voorwaardes geld. last week for all up- and coming artists to enter a portfolio of their work. However, we are eagerly awaiting more exciting entries from up- and-coming artists NEW for a new project to be launched next month. A panel of experts will select 10 lucky entrants who will be offered an opportunity to exhibit and sell their artwork during a special event in Bloemfontein on 6 September 2018. All up-and- coming sculptors, painters, etcetera, are welcome to send pictures of their work, accompanied by contact details and a short CV, to info@ bloemfonteincourant. co.za on or before 19 August 2018. 4 COMMUNITY NEWS • GEMEENSKAPSNUUS www.bloemfonteincourant.co.za • [email protected] • 9 August 2018 Young Bfn model goes international PIERCE VAN HEERDEN [email protected]

“I’m the master of my faith and the captain of my soul.” These are the words of 14-year-old Tatum Macalagh, who is taking the modelling industry by storm. Tatum, from Heidedal, Bloemfontein, a learner at Brebner High School, recently got the opportunity of a lifetime when she was scouted by one of the biggest modelling HTS Louis Botha het weer as die kampioene in die Vrystaat A-rugbyliga weggestap. agencies known in the industry. FanJam Model Management, with its head office in Cape Town, is known to provide HTS kraai 9de keer koning local aspiring and professional models the opportunity to walk for the biggest fashion JERETHA OOSTHUIZEN “Ons het daagliks bitter hard geoefen en houses and appear on the covers of the [email protected] die manne was baie toegewyd. Ons is best magazines. CK, Versace, Jill Sander, opgewonde oor die toekoms en die feit Valentino, Vogue, Elle, Cosmopolitan, are Die Hoër Tegniese Skool Louis Botha het vir dat baie spelers volgende jaar weer vir die a few of their leading clients. Tatum, who die 9de keer in die A-skolerugbyliga koning eerste span kan uitdraf,” sê Jansen van could not believe it when FanJam discovered gekraai. Rensburg. her on Instagram, is over the moon about Die eerste rugbyspan het die afgelope Dit is vanjaar al die negende keer uit elf the opportunity. “At first I was shocked and Saterdag op Shimlapark teen die Hoërskool dat die span die beker in die liga huis toe excited at the same time. I couldn’t believe Sentraal uitgedraf om die Vrystaat A-liga- vat en die derde keer in ’n ry dat die span it, because FanJam Model Management is a eindstryd 47-15 te wen. die eindstryd haal en wen. Asof dit nie big agency with great clients internationally,” Tatum Macalagh PHOTO: AHEE PHOTOGRAPHY “Ons het gedink dit gaan ’n moeilike genoeg is om op trots te wees nie, speel die Tatum said. eindstryd wees aangesien die telling jong manne dié naweek in die Kovsieliga Yolande Macalagh, head of eModels baie nader aan mekaar was met ons se semi-eindstryd en spog hulle met sewe in Heidedal and also mother to Tatum, A few years ago when Tatum joined ligawedstryd,” het die span se afrigters, spelers in die Cravenweekspan, nege in die describes her as a passionate young girl who eModels Bloemfontein, her mentor was Werner Jansen van Rensburg en Mokoa Akademie-span, twee in die Arendespan en sets goals and always speaks life into them. Jeanre Neethling. “She is a phenomenal Bolofo, vertel. een in die Vrystaat-onder 17-span. Tatum started her modelling career from a woman with a great personality and a heart of Die span het ’n uitstekende rugbyseisoen Elke speler het sy kant gebring en young age as her mother has always been gold. She’s driven me to excellence and has gehad en het elke wedstryd waarin hulle uitblinkers was onder andere Francois active in the modelling industry. made me believe that I am the #chosenone,” teen die Hoërskool Sentraal, Jim Fouché, Boonzaaier, LihleLolwane, Zongi Nxiya, “My role model is a unique, significant, Tatum said. Fichardtpark en Landboudal gespeel het, Brandon-Lee Adams en Jaden Seekoei in. God fearing woman, my mother. She’s my As a female model, her message to vir ’n telling van meer as 40 punte op die “Ons is bitter trots op die span en sien uit motivator and inspires me to reach my goals other girls is, “Be yourself, walk with your telbord gesorg het en meer as vier drieë in na wat volgende gaan gebeur. Die spelers and to set them to a higher standard, to head held high. It doesn’t matter what your elke wedstryd gedruk het. het ’n liefde vir die sport en hul gees verklap believe in myself and give my all in anything I circumstances at home are, don’t let that Die afrigters se harte loop oor van trots. dit!” sê Bolofo. do,” Tatum said. bring you down.” HemelBesem skiet nuwe video in Heidedal PIERCE VAN HEERDEN wat bekendstaan as die hardwerkende Suid- [email protected] Afrikaanse Afrikaanse hiphopkunstenaar, onlangs sy nuwe musiekvideo in Heidedal, Hy is nie net ’n bekroonde rapper nie, maar in samewerking met Just Faith Productions, gebruik ook sy profiel om bewusmaking geskiet. Die musiekvideo van sy nuwe oor verskillende kwessies in Suid-Afrika te liedjie, The Happy Song, is geskiet en skep, terwyl hy help met die opheffing van gerig deur Vincent “Chicco” de Koker van gemeenskappe. Heidedal. De Koker, wat ’n gevestigde Die gewilde Pasella-aanbieder, akteur is, het die musikant by die Vrystaat skrywer, aktivis, rapper, digter, Kunstefees ontmoet en beskryf hom as HemelBesem tussen ‘n klomp kinders tydens die verfilming van sy jongste musiekvideo. opvoeder, motiveringspreker en ’n mense-mens. “Die musiekvideo het vermaaklikheidspersoonlikheid, afgespeel in Heidedal en met mense van video en ’n voorreg om met so groot naam in uitstaan, is die ongelooflike terugvoering wat HemelBesem, was onlangs te sien in Heidedal,” vertel De Koker. “Die Happy Song die bedryf af te skop,” sê De Koker. ons van die gemeenskap af gekry het, asook Heidedal, Bloemfontein, vir ’n baie spesiale het ’n baie sterk boodskap en Heidedal was De Koker en sy span het die video binne die ondersteuning.” rede. die perfekte plek vir die musiekvideo. Dit ’n dag geskiet. Dit speel af in vyf verskillende HemelBesem se nuwe video sal op 1 Gebore Simon Witbooi, het HemelBesem, was Just Faith Productions se eerste musiek plekke in Heidedal. “Wat vir ons as ’n span September 2018 op kykNET wys.

ALL PRICES - EXCLUDING VAT ½M³ 1M³ ½M³ 1M³ 2M³ 3M³ 4M³ 5M³ 6M³ 10M³ 12M³ GRAVEL (SIFTED) R 90 R 160 R 280 R 290 R 530 R 660 R 800 R 950 R 1 025 R 1 580 R 1 770

GRAVEL (UNSIFTED) R 80 R 140 R 260 R 270 R 435 R 585 R 690 R 810 R 940 R 1 520 R 1 650

GRAVEL STONE (+13MM) R 80 R 140 R 260 R 270 R 430 R 585 R 690 R 810 R 940 R 1 320 R 1 650

PLASTER SAND R 110 R 205 R 340 R 380 R 580 R 830 R 1 030 R 1 280 R 1 450 R 2 600 R 2 850

BUILDING SAND R 90 R 160 R 270 R 290 R 540 R 660 R 790 R 950 R 1 040 R 1 650 R 1 780

SIFTED BUILDING SAND R 95 R 175 R 285 R 305 R 555 R 675 R 805 R 965 R 1 130 R 1 760 R 1 960

CONCRETE SAND (BETON) R 143 R 249 R 290 R 365 R 620 R 955 R 1 155 R 1 425 R 1 705 R 2 775 R 3 300

TOPSOIL/ROOIGROND R 90 R 153 R 260 R 270 R 430 R 585 R 690 R 820 R 930 R 1 500 R 1 700

CRUSHER DUST R 238 R 429 R 450 R 515 R 985 R 1 545 R 2 055 R 2 570 R 3 870 R 4 650 R 5 550

6.7MM STONE R 235 R 429 R 375 R 495 R 911 R 1 340 R 1 716 R 2 145 R 2 470 R 3 975 R 4 765

13MM STONE R 235 R 429 R 455 R 500 R 970 R 1 385 R 1 820 R 2 250 R 2 570 R 3 975 R 4 750

19MM STONE R 230 R 429 R 450 R 495 R 960 R 1 370 R 1 800 R 2 200 R 2 540 R 3 975 R 4 750

BUILDERS BLEND R 225 R 429 R 450 R 495 R 950 R 1 370 R 1 820 R 2 250 R 2 560 R 3 985 R 4 760 ,W LVVWKKHVHV DVRQRQ IRURUTTXLLQFQFHVVDQDQLQGLQGGLVLVSHS QVQVDEDEOHHSSDUWWRIIDDQ\SSDDQQWUW \&&KDK QFQ HVDDUHWKDWDUH WKDW\\RXU RXUQHLJKERXUVSUREDEO\Q QHLJKERXUVHLKLJKERXUVSUREDEO\EESUREDEO\ SUREDEOEO\KKKWDYHDYHDWDWUHHVLQFHUHHVLQFHTXLQFHVDUHUHH VLQFLLHTTXLQFHV DUH FRFRPPP RQRQ WRR)UUHHH 66WDDWH JDUD GHQVV EXXWWWKWKHVHHKDKDUGG\\\ZLLQWHUIIUXLWVV DUHH DDOOVRV ZZLGL HOO\\\DYDLODEOHI IURPURPJJUUHHQJ JURFHUJURFHUVJUURFHUVV&& &KHIKHKHI1LHPDQGVKDUHVDIRROSURRIUHFLSHI1 1LHPDQLHPDQGGV VKDUHVKDUHV DIRROSURRSURRIIUUHFLHFLSHS 77KKHHVVHHV\V\UXUXS\S\ TXXLLQQFFHHVV DUHUH JUUHHDDWW ZLZLWLWWKKKYYHHQLQLLVVVRRQQGGLLVVKKHHVV LQQVVHHDDVVRRQQDDWWDDVVWW\\ ZZDDUUPP WRSSLQJIRULFHFUHDPRUWKH\FDQEHXVHGLQDSLHWRSSLQWRWRSRSSSSLQLLIJJIIRRRUU LFLLW LFHFH FFUFUH FUHDPUHHDPP R RUU WWK WKH\KEH\H\ F FDQDQ E EHH XVXVVHGHGGLLQL D SSLHLHLH

05th September : Chocolate Demo (partially hands on) R500 6 NEWS BITS • NUUSFLITSE ‘Muito Obrigado’ aan ‘n unieke stad Dit is af en toe nodig om uit jou gemaksone te kom. Een manier om dit STORIESMOUS te doen, is om jouself te dwing om soms besoek af te lê by vreemde plekke wat nie op jou kortlys van droombestemmings is nie. Ek het onlangs vir my seun, Marco, wat ALBÉ GROBBELAAR in Beira werk, gaan kuier. Beira is ’n kusstad in Mosambiek, sowat 1,200 km noord van Maputo. vra ek teleurgesteld. Die kelner druk sy Kom ons sê dit maar reguit vir vinger amper binne-in die eier. “Ovo!” sê mekaar: Dit is nie jou tradisionele hy. Toe mompel ek maar net dankie in toerismebestemming nie. Maar juis dít Portugees. “Obrigado” is al woord wat ek gee aan hierdie stad, met sy nagenoeg ken. halfmiljoen inwoners, ’n unieke karakter. Beira se strande en unieke vuurtoring, Jy voel nie soos ’n toeris wat om elke met die twee skeepswrakke daar naby, is hoek en draai uitgebuit word nie. ’n bekende baken. ’n Mens kan lang ente Die feit dat my seun vlot Portugees langs die see stap sonder om onveilig te praat – waarop sy pa baie trots is – maak voel. Die besige hawe is ook ’n besoek natuurlik ’n groot verskil. Want met werd. Beira se hawe is die invoerpoort Engels kom jy nie ver nie. vir Zimbabwe, Zambië en Malawi. Daar Marco het lekker gelag toe ek hom vertel is ook die geskiedkundige standbeeld van my poging om een oggend self ontbyt van Mosambiek se eie Madiba, Samora by ’n kroegie langs die strand te bestel. Machel, op die stadsplein. En dan Ek dag ek vra vir ’n toebroodjie met natuurlik die pragtige Our Lady of the avokadopeer op. In hierdie sub-tropiese Rosery-katedraal, wat byna 100 jaar oud omgewing, waar avo’s aan elke derde is. boom hang, kan “ovo” op die spyskaart Maar die wonderlikste van alles was om tog net een ding beteken. ’n hele week lank by my Beira-seun te Toe bring hulle vir my ’n reuse-hamburger kon kuier. Geen besienswaardigheid kon met ’n eier bo-op. “Where is my ovo?” daarby kers vashou nie.

Junior hengel op ‘n ander vlak Op Saterdag 4 Augustus 2018 het die Pro Mania Fishing Academy een van hul “Kids Fishing”- toernooie gehou waar inwoners van regoor die Vrystaat saam met hul geliefdes by Krugersdrift bemekaargekom het. Kinders van alle ouderdomme kon meer leer oor visvang en self die kuns beoefen, alles gepaardgaande met groot pret. Vir meer inligting, besoek [email protected] FOTO: PIERCE VAN HEERDEN Mojaki releases her fourth album The veteran gospel singer, Makgala Mojaki The new album will be officially launched from Botshabelo, who started her music on 18 August 2018 at the Botshabelo career in a clap-and-tap choir 30 years ago, Nicro Hall with guest artists such as has just released her fourth studio album Nomathembu Mabeka from Joyous titled Kae Leboha. Celebration. To get a copy of the album, But her journey wasn’t always smooth call Mojaki on 083-9922-580. – Lebakeng ,V\RXUEXVLQHVVRUEXVLQHVVLGHDEULOOLDQW" sailing. “I have faced many challenges Nkabi 'R\RXNQRZKRZWRSLWFK\RXUEXVLQHVVRULGHDHIIHFWLYHO\" before I became the person I am today. I :RXOGH[SHUWEXVLQHVVDGYLFHKHOS\RXWDNHLWWRWKH have three gospel albums under my belt, QH[WOHYHO" which are Rejoice, O Molimo, Oyahalalela, (1*(13LWFK 3ROLVKWKHQDWLRQDOHQWUHSUHQHXULDOZRUNVKRS and now I have just released my fourth DQGFRPSHWLWLRQSURJUDPPHLVFRPLQJWR\RXUWRZQ studio gospel album, titled Kea Leboha. “This album, which was produced by Nkosi 6SHQGWKHGD\LQDIUHHZRUNVKRSDQGJHWWKHH[SHUWJXLGDQFH Nikelo, is my ‘Thank You album’. I say thank \RXQHHGLQRUGHUWRSLWFK\RXUEXVLQHVVRULGHDWRSRWHQWLDO you to God Almighty and to my fans for the LQYHVWRUV Makgala support,” said Mojaki. Mojaki :KHUH :KHQ 3UHVLGHQW+RWHO 8QLRQ$YHQXH Leerling reik uit %ORHPIRQWHLQ 6DWXUGD\$XJXVW na jonges

7LPHV Cornisha Maasdorp (17), 5HJLVWUDWLRQVRSHQDWDP ’n graad 10-leerder aan die 6WDUWVDWDPDQGHQGVDWSP Hoërskool Heatherdale en finalis in die Mej. Heidedal- kompetisie, het as deel van haar 7LWOHVSRQVRU 6SRQVRUHGE\ 3RZHUHGE\0HGLDSDUWQHU pligte as finalis ’n insameling gehou om twee leerders van die Laerskool Olympia vir ’n dag lank te bederf. Benewens ’n heerlike ontbyt het die twee ook winterklere, skoolbenodigdhede en komberse en kospakkies van Cornisha ontvang. Van links is Rebabaletswe Mokake (graad 3), Cornisha, Shalie-Jehndra van Schalkwyk (graad 2), en 5606)UHH606VGRQRWDSSO\(UURUVELOOHG1HWZRUNFKDUJHVH[WUD Johan Vorster van Oranje Toyota, $OOSULFHVLQFOXGH9$77 &V#ZZZSLWFKDQGSROLVKFRP5DL]FRUS+HOSOLQH wat die komberse geskenk het. 9 August 2018 • [email protected] • www.bloemfonteincourant.co.za SCHOOLS • SKOLE 7 Musiekfees ’n moet-sien vertoning JERETHA OOSTHUIZEN Katleho Maboe en Connell Cruise op die [email protected] verhoog om saam met die skool se leerocers op te tree. Vorige jare was bekendes soos Dit is eersdaags tyd vir die jaarlikse Theuns Jordaan, Steve Hofmeyr en Karen musiekekstravaganza, die Grey-kollege- Zoid deel van die blyspel. musiekfees. Dit is duidelik dat die direkteur van musiek Die oorspronklike koorfees van Grey is in by die skool en die oragniserder, Hattingh 2005 deur Johan Volsteedt verander na ’n Davel, baie ure aan die seuns bestee om musiekfees en die gebeurtenis het ’n jaarlikse seker te maak hulle is op hul beste en ’n moet-bywoon vertoning in die Sand du slaggereed vir die musiekfees. Die Indomitus- Plessis-teater op mense se kalenders geword. koor het immers pas van die Wêreld Vanjaar se tema is Untouchable. Dit verwys Koorspele teruggekeer met ’n silwermedalje. na die fisieke krag van die groep seuns, die Met vele borge aan boord het Johan Pyper, bloed, sweet en trane en die mag om saam ’n die senior bemarker van NWU, gesê: “Dit is storm te konfronteer. jaarliks ’n wonderlike geleentheid om by te “Dit is ’n baie spesiale vertoning met woon. Ons glo daarin om geleenthede vir jong baie spesiale kunstenaars,” vertel Brenda mense te skep om hul talente uit te beeld.” Mybrugh, wat deel van die organiseringspan Die musiekfees vind vanjaar op 24 Augustus is. om 19:00 en 25 Augustus om 12:00 en 19:00 Vanjaar verwelkom die spogskool in die Sand du Plessis-teater plaas. Kaartjies Die Indomitus-koor is hard aan die werk en is slaggereed vir vanjaar se musiekfees. kunstenaars soos Izak Davel, Caroline-Grace, is beskikbaar by Pacofs. FOTO: PIERCE VAN HEERDEN Tralie laat speke sing Sand du Plessis haal Laerskool Bloemfontein se slimmes Jim Fouché leerling Kiewietspan blink uit

Corné Beyers van die Hoërskool Jim Fouché het die Hennie Joubert Eben van Rooyen van die Hoërskool Merietebeurs van UNISA ontvang. Hy Sentraal het aan die derde en vierde het ook tydens die Julievakansie met Graad 6-leerders van die Laerskool Bloemfontein het deurgedring rondes van die Vrystaat-streek MX sy vioolspel die geleentheid gehad John Barrington en Harry Jooste van die Hoërskool tot die semi-eindronde in die Enviro-Quizz (Omgewingsvasvra). Voor 85-klas deelgeneem en in albei rondes om saam met ‘n nasionale orkes in Sand du Plessis het die o.16-Kiewietrugbyspan is Anje van Staden, Janré Bothma en Christiaan Prins. Agter is eerste plekke behaal. Stellenbosch te speel. gehaal. Lesedi Kgafela, Anja Pelser en Elsje-Mari Milne. 8 ENTERTAINMENT • VERMAAK

DIe groep, Kirkland FOTO: RED VINE PHOTOGRAPHY Kirkland laat dit juig! JERETHA OOSTHUIZEN aan en maak dit duidelik dat hulle ’n 2016 aan SA’s deelgeneem het, [email protected] passie vir hul musiek het. “Ons kan met ’n persoonlike beste tyd van een oomblik baie rustige, intieme 47,3 sekondes. Die groep, Kirkland, is besig om ballades doen, en direk daarna ’n Vir die res van die jaar beplan hulle gate uit te geniet op die upbeat song wat mense laat dans. die groep hul tweede Afrikaanse verhoog en hul nuutste treffer, Net Dan sing ons ook in Afrikaans en enkelsnit, wat tans opgeneem na Nege, het pas die lig gesien. Engels,” verduidelik hulle. word en wat hulle in September Hein Geldenhuys, op vocals en Elke lid van die groep bespeel gaan vrystel. Daarna wil hulle kitaar, en Callie van der Merwe, nie net ’n instrument nie, maar moontlik ’n EP of vollengte CD, wat ook die kitaar tokkel en selfs elkeen het ook ’n rol waarvoor hulle waaraan hulle nou begin werk, klavier speel, was vantevore in ’n verantwoordelik is. Geldenhuys is vrystel. band, maar het besluit om weg te ook die ‘baas’ as dit kom by liedjies Die geheim agter die sukses van breek en self iets ernstigs te begin. skryf. Hy skryf oor alledaagse die groep? “Ons probeer elke gig Hulle het toe ’n vriend, Willem gebeurtenisse wat ’n impak speel na die beste van ons vermoë van der Merwe, wat baskitaar op ’n mens maak. “Dit kan iets en ons geniet dit net. Daar is twee speel, genader en oudisies vir persoonliks wees of iets wat in die goeie vriende van die band, wie ’n tromspeler gehou, waarná media verskyn wat ’n inspirasie is,” se motto, Laat Dit Juig, is en dis Louwrens Kock ingesluit is, en so sê hy. presies wat ons probeer doen met het Kirkland ontstaan. Natuurlik het elke lid ook elke vertoning – ons laat dit juig!” Die groep beskryf hul genre as iets privaats wat deel is van Vir enige navrae oor die groep of enige iets van folk rock tot pop. hul persoonlikhede. Hein het vir besprekings, kontak gerus vir “Ons probeer nooit ons musiek provinsiale krieket op skool gespeel Callie by 064-906-9070 of stuur ’n label nie, en laat elke song in die en doen ook ju-jitsu en bergfietsry e-pos na [email protected]. rigting gaan waarin dit die beste in sy vrye tyd. Callie is lief vir skaak Besoek ook hul webwerf by pas. Ons probeer nooit iets forseer en het ook provinsiaal deelgeneem. www.kirklandband.com. Daar kan nie, maar geniet dit om wel te Willem is bietjie van ’n nerd. mense al hul inligting, gig-datums, eksperimenteer,” vertel hulle. Hy speel videospeletjies, musiek en kontakbesonderhede Die uniekheid van die groep maak versamel trading cards en speel kry. Gaan kyk gerus ook na hul hulle beslis besonders. Hulle pak bordspeletjies, terwyl Louwrens ’n Facebookblad by https://www. ’n wye verskeidenheid musiekstyle 400 m-atleet is wat tussen 2011 en facebook.com/kirklndband/ Bloem DJ celebrates 35 years in the music industry

MOLEBOGENG MALEBO experience, [email protected] Blow has invited some of “You learn lessons every day. Just the best local believe in yourself.” These are the DJs and his words of local DJ, Kurbin Blow, industry friends who celebrates a career spanning to join him in over three decades – 35 years to to entertain the be exact. audience. The This legendary club DJ and line-up includes Motheo FM radio personality was popular local born and bred in Bloemfontein. He DJs such as became a DJ at the age of 15 after Dick, Jontaz being discovered by someone who and Tommy. saw great potential in him and he “I might be hasn’t looked back ever since. Blow always had a dream of becoming a DJ, but it wasn’t I can’t leave music, initially part of his life music will leave me plan. He credits his one day great love of music and seeing people - DJ Kurbin Blow enjoying themselves while dancing to the music, as the things that have kept him going over the getting older, years especially during hard times. but I have Blow is also turning 50 this no plans of DJ Kurbin Blow month. And to celebrate these two slowing down milestones, he is throwing a huge anytime soon. bash from 20:00 on Saturday 18 I can’t leave “Make sure that DJ-ing is what August at Club Zanadu in Krause music, music will leave me one you want to do, because it can be Street in Oranjesig. The entrance day. That’s when I’ll give up,” he a tough industry to work in. If you fee for the event will be R20 before told Bloemfontein Courant. have a passion for it, by all means 22:00 and R30 thereafter. The Blow also offered some words of go for it. ladies can look forward to a free wisdom to all up and coming DJs Don’t ever sell yourself cocktail. who are seeking to have longevity short, and don’t let people take To make this an unforgettable in their career. advantage of you,” he said. Buy 2 for R4 999 50% 50% off off

GHOST SAVE R STUDIO SAVE R ADELLE SAVE R SHELL SAVE R high fashion clear arm chair 700 leather look sleeper couch 3 700 elegant designer modern chair 7 000 occasional chair 4 000 was R1 399 R •for everyday living, R •diamond button back R was R7 999 R 699ea real value for money 1 299 •stainless steel frame 2 999ea 3 999ea was R4 999 was R9 999 In Celebration of Women’s Month 5DayEvent Wednesday 8 - Sunday 12 August

white provence champs ISCHIA double base set •maxi inner spring system for comfort & support stainless champs •comfort stabiliser foam core steel legs provence for added stability R CHRIS SAVE R7 000 was R4 999 SAVE 1 000 classy fabric corner suite R with stainless steel legs R now 3 999 was R13 999 6 999 in-store newIntroducing our range R BASE SET STANDING MIRRORS SAVE 1 100 was R2 599 R Sleep Well, Dream Big! ea New & 1 499 Improved

CHAIN CHAMPION round mirror queen base set KITTY SAVE R8 000 was R2 599 •luxurious pillow top provides massive 3 division sofa SAVE R cushioning for enhanced comfort •elegant deep diamond button back R 800 •poly-wool technology assists in •luxurious fabric •double studded arm 9 999ea R regulating body temperature available in various colours 1 799 R was R17 999 was R5 999 SAVE 1 000 50% R4 999 Also available in single, off double, king & extra length VISION fabric corner suite •upholstered in luxurious quality fabric •stainless steel legs was R19 999 SAVE R STAR 10 000 queen base set R •pillow top comfort adds a luxurious 9 999 comfort feel to the support system •double offset coil system delivers correct back support with no roll-together R was R6 999 SAVE 1 000 adjustable armrests R Also available in single, 5 999 STELLA double, king & extra length LED 2 piece modern light inlay designer leather suite •100% genuine leather uppers limited edition styled & designed •designer curved arms GEO was R37 999 3 piece oyster white bedroom suite R •geometric patterned with SAVE 18 000 100% LED light inlay headboard genuine leather was R19 999 R uppers 19 999 SAVE R11 000 R soft supple leather - 6 seater - not 5 like most on the market!! 8 999

includes 2 large studded nightstands

CHRISTIAN GREY 3 piece bedroom suite •studded headboard & nightstands was R19 999 SAVE R9 000 BELLWOOD SAVE R 3 action corner suite 20 000 R •100% genuine leather uppers R 3 action corner suite 1st 10 999 •2 recliners & 2 cup holders 29 999 was R49 999 time launched in SA!!!!

50% off styled & designed TIFFANY CLIO 9 piece exquisite black glass 7 piece modern dinette dining room suite •award winning wooden base and •100% stainless steel with 6 exquisite stainless steel dining chairs diamond button back chairs was R27 999 was R39 999 SAVE R14 000 SAVE R17 000 R13 999 R22 999 These specials are only available at LOCH LOGAN NORTH CAPE MALL BLOEMFONTEIN WATERFRONT KIMBERLEY

Other stores situated in ALBERTON, BENONI, BOKSBURG, CENTURION, DURBAN/UMHLANGA, DURBAN/SPRINGFIELD, FOURWAYS, HAZYVIEW, KEMPTON PARK, KOLONNADE, KWAMASHU, MALL@CARNIVAL, MALL@REDS, MENLYN, NELSPRUIT, NORTHGATE, adv pharcyde PARK MEADOWS, PIETERMARITZBURG, POLOKWANE, RICHARDS BAY, RUSTENBURG, SANDTON, SOUTHGATE, STRUBENSVALLEY, THOHOYANDOU, VEREENIGING, WESTGATE, WITBANK & WONDERPARK

Prices valid until 12 August 2018 or while stocks last - Not all advertised lines are available on display in all stores follow us on: united furniture outlets @ufo_furniture view our extensive range on www.unitedfurnitureoutlets.co.za Stocks are limited and some products may be subject to order lead times - E&OE 10 ENTERTAINMENT • VERMAAK www.bloemfonteincourant.co.za • [email protected] • 9 August 2018

PENCIL IN

Estate and Spa from 19:00. De Oude Kraal 11 Augustus will be preparing a fine dining menu with Die Rooikerk hou weer dishes to complement each wine. Tickets fliekaand. Die gewilde film, are R450 per person. Book your spot at The Greatest Showman, 051-564-0636 or [email protected] word om 18:00 vertoon by die NG Universitas-Wes 9 Augustus se Gemeenskapsentrum Die Franse Mark vind by Villa Avianto in De Bruynstraat. Bring van 08:00 tot 15:00 plaas. Toegang is R20 a stoel of kombers en ’n per persoon. Kontak 083-329-4872 vir piekniekmandjie. Springmielies meer inligting. sal voorsien word.

10 August 13 August Sarel Greyling and Anton Esterhuyse The Free State Branch of pay tribute to Joe Cocker and friends at the Genealogical Society 19:30 at Innie Skuur. of South Africa holds its next meeting at 18:30 in the 10 Augustus auditorium of the Anglo-Boer Wynproe saam met Spier Landgoed en War Museum. The speaker Bacchus Nel van 19:00 tot 23:00 by 59 will be Pieter Bothma on the Plenty. topic of his ancestors, going Jan Braai back to the original Vryburgers of the Cape. Visitors are welcome and will 18 Augustus be charged R20 each. Tea and coffee will Touch of Class unplugged vind om 20:00 be served. Contact John Webb on 051- in die Aasvoëlklub plaas. 436-8537 for more info. Kaleidoskoop FOTO: FACEBOOK - HANNERI 19 Augustus DE WET PHOTOGRAPHY 16 August Braai met Jan Braai van 10:30 tot 18:00 Sushi Workshop at 59 Plenty starting at by Kaya Beach. Kaartjies beskikbaar by 9 August 18:00. Costs are R240 per person. kayabeach.co.za teen R60 per persoon. Her Worth luncheon takes place at 10:30 at New York Restaurant, 2nd Avenue. It’s 16 August 19 Augustus an empowering event for the ambitious Strawberry and Champagne evening Du Preez Stoltz stel sy nuwe album om woman who wants to master her finances taking place at House of Interior from 10:00 by die Klipkerk bekend. and network with other businesswomen. 18:00 to 20:00. The theme is dusty pink and white and the 19 Augustus dress code is Dress for Success. Tickets 17 Augustus Kom hou Piekniek in die Tuin saam met cost R350. Contact 061-493-7069. Jennifer Jones en Margie Anderson tree die musiekgroep Kaleidoskoop by Warm saam op by die Aasvoëlklub om 19:30. Karoo & The Kitchen van 12:00 tot 14:30 9 August Kaartjies kos R150 en is vooraf beskikbaar teen R140 per persoon. Koste is R95 per The Food and Wine pairing with Klein by Kiki Corner in Langehovenpark of Toms ete as jy belangstel. Constantia at De Oude Kraal Country PHOTO: THE FERMENTED FRUIT Music Shop.

METRO MUNICIPALITY METRO MUNISIPALITEIT LEKGOTLA LA MOTSE

openbare KennisGewinG

Gids vir voorafbetaalde watermeters MMM word oorval met navrae in verband met die laai/verkoop van strokiebewyse (tokens) vir voorafbetaal-watermeters. Hieronder is riglyne vir die stappe wat geneem moet word indien u enige uitdagings ervaar met u strokiebewys/e.

VRAE WAT DIKWELS GEVRA WORD: oproepsentrum skakel vir KCTs (Key Change VERKEERD- WAT DIT BETEKEN Tokens) om die meter weer in te stel (reset) vir KODE 1. Ek kan nie water enige plek koop nie omdat die korrekte verskaffer. 002 Ongeldig. Nie ‘n waterstrokiebewys hulle sê my meter is ongeldig 5. Ek kan nie my balans sien nie, die sleutelvord wys net die meternommer en 004 Gebruikte strokiebewys. Strokiebewys is voorheen gebruik AKSIE: Skakel die inbelsentrum by -tyd 008 Strokiebewys te oud. Vra nuwe strokie aan 0800111300 om uit te vind of die meter geregistreer is SMS of WhatsApp u adres, AKSIE: Kyk of die meter buite flits of 016 Meter is versadig. Geen krediet kan bygevoeg word nie meternommer en probleem na 076-342- 1314 dood is. As dit flits of dood is, kontak die 017 Ongeldig. Inspekteer SGC of tik strokie reg in oproepsentrum om ‘n foutiewe meter aan die 2. Ek het die nommer op die strokiebewys instandhoudingspan te rapporteer. As dit aan 018 Vervaardigingskode. Foutiewe strokiebewys, vra nuwe aan probeer laai maar kry ‘n verkeerd (error)- is en alles reg lyk, probeer die bewysnommer 019 Sleutel verval. Kontak asb verskaffer, vervang of opdateer boodskap intik wanneer u nader aan die meter staan. 020 DDTK-sleutelfout. Kontak asb verskaffer, vervang of opdateer Skakel die inbelsentrum om die AKSIE: 6. Ek kry steeds ‘n verkeerd-lesing wanneer 021 KC-tikfout. Kontak asb verskaffer, verskaffer, vervang of opdateer verkeerd-kode te probeer verwyder SMS ek my nuwe strokiebewysnommer intik, of WhatsApp u adres, meternommer en selfs nadat ek die KCT (Key change tokens) 022 Formaatfout. Strokiebewys is foutiewelik uitgereik, vra nuwe aan probleem na 076-342- 1314 ingetik het Reikwydte (range)-fout. Strokiebewys foutiewelik uitgereik, vra nuwe 023 aan 3. My sleutelbord (ook na verwys as UIU) wys AKSIE: U moet op die plek wees waar die 024 Funksiefout. Funksie aangevra nie geïmplementeer geen reaksie op my meter nie meter is. Kyk of die meternommer op die sleutelbord dieselfde is as die op die meter. 1STS KCT Goed ja. Strokiebewys is korrek ingetik AKSIE: Kyk of die meternommer wat op die Kyk of die meter flits en of dit dood is. As die 2STS KCT Goed ja. Strokiebewys is korrek ingetik SLEUTELBORD (keypad) wys, dieselfde is as meter flits of dood is, rapporteer dit aan die die een op die meter buite. As dit verskil, moet oproepsentrum. As daar niks verkeerd is met 018 Vervaardigingskode. Foutiewe strokiebewys, vra nuwe aan u u sleutelbord in ooreenstemming bring met die meter nie, probeer weer die nommer intik 019 Sleutel verval. Kontak asb verskaffer, vervang of opdateer u meter deur #999#meternumberonbox# te terwyl u langs die meter staan. As niks werk druk. As dit dieselfde is, kyk of u meter flits nie, kontak die oproepsentrum vir bystand. 020 DDTK-sleutelfout. Kontak asb verskaffer, vervang op opdateer of dood is. As die meter is dood is of flits, 021 KC-tikfout. Skakel asb verskaffer, vervang op opdateer rapporteer die meter by die oproepsentrum. 7. My meter is vervang maar hulle het nie die balans van my ou meter terugbetaal of 022 Formaatfout. StrokiebBewys foutiewelik uitgereik, vra nuwe aan 4. Ek kan nie my strokiebewys gelaai kry nie oorgedra na my nuwe meter nie Reikwydte (range)-fout. Strokiebewys foutiewelik uitgereik vra nuwe 023 aan AKSIE: Kyk of jou strokiebewys op die AKSIE: Kontak die oproepsentrum met die 024 Funksiefout. Funksie aangevra nie geïmplementeer korrekte SGC (Supplier Group Code) is. besonderhede van u ou en nuwe meter om Indien die strokiebewys op SGC 400060 te vra vir ‘n terugbetaling van die oorblywende 1STS KCT Goed ja. Strokiebewys korrek ingetik is, moet u die oproepsentrum kontak vir ‘n balans van u ou meter. Dit mag ‘n redelike tyd 2STS KCT Goed ja. Strokiebewys korrek ingetik terugbetaling van die strokiebewys. Indien die neem aangesien ons werkswinkelspan die strokiebewys op die korrekte SGC (400140) oorblywende balans moet verifieer op u ou is en u dit steed nie kan laai nie, moet u die meter. ADV. TANKISO MEA - STADBESTUURDER

Uitgegee deur MMM Communications www.mangaung.co.za | FB: Mangaung Metropolitan Municipality Official Oproepsentrum– 0800 111 300 9 August 2018 • [email protected] • www.bloemfonteincourant.co.za WOMAN’S DAY • VROUEDAG 11

Annette Kasselman, Director and Dimpho Motshabi, Marketing Mimie Jacobs, Female Farmer of the Thando Mohlamme, Group Human Neelofar Issa, Mimosa Mall General Property Consultant of RealNet Manager of the Bloemfontein Property Year 2016 Resources Manager of Central Media Manager Properties Practitioners Institution Group ‘Women’s Day should be celebrated every day’

MOLEBOGENG MALEBO Day as a day we should be me represents female heroes and hopes to use the platform as will be attending a women’s church [email protected] celebrating every day. “I believe who fought for South Africa. The tool that will help other women gathering which involves a prayer that empowered women empower freedom they fought for is the understand their purpose and who session and a memorial service. Women’s Day is the annual other women. If we stick together freedom we enjoy today. Women they are as women. Lastly, Mimosa Mall General commemoration of the historical and believe in ourselves we can have enough power to bring huge Thando Mohlamme, Group Manager, Issa Neelofar, Issa noted Women’s Day march, which took conquer the world.” She will be change to the country.” Human Resources Manager the importance of commending place on 9 August 1956 and saw celebrating Women’s Day by Mimie Jacobs, a farmer by of Central Media Group, women on this day. “We celebrate 20 000 females of all races uniting attending a women’s meeting profession, sees Women’s Day as acknowledges the impactful step how far we’ve come as women to present a petition against the where she hopes to inspire other quite an important day. “It is the that the women took in 1956: and what we’ve achieved over the carrying of passes. Bloemfontein women. She will also be spending acknowledgement of the female “Women’s Day means liberation past decade or so.” She hopes Courant spoke to some prominent time with the women in her life. gender, the emphasis on the in the sense that I am always to empower young women with female figures in Bloemfontein to Marketing manager of the protection of the female gender and reminded that there are women the position that she holds. She hear what the day means to them Bloemfontein Property Practitioners empowering the female gender. who stood up for me to be where plans on spending the day by and how they will be celebrating Institution (PPI), Dimpho Motshabi, Women are applauded on the I am today, therefore, I have to reflecting on the achievements of Women’s Day this year. is attending a women’s conference day and their achievements are emulate the same characteristics her entire team (it has been quite Annette Kasselman, director that will be held at the church she celebrated.” The 2016 Free State that they had.” a challenging couple of months and property consultant of RealNet attends. She shared her thoughts Female Farmer of the Year winner She is choosing to spend the for them) while not forgetting to Properties, considers Women’s on the day: “Women’s Day to was invited as a keynote speaker morning with her female friends and recuperate.

Teeparty by Progress and empowerment Heide gehou Die Laerskool Heide in Heidedal of women het Saterdag ’n vroueteeparty in die skoolsaal aangebied. Die A DIFFERENT tema van die teeparty, wat gehou As we celebrate is om geld vir die skool in te National Women’s PERSPECTIVE samel, was “Hats and Heels”. Month in August, By die geleentheid was van links let us reflect on the Isabel Beukes, Jolien Alexander, complementary Margo Fargo (gasspreker), roles of men and Margaret Moeletsi en Sharon FLORA TECKIE McKenzie. women and the impact of equality on creating a more balanced and a peaceful world. qualities in which women are The progress and strong. empowerment of women and According to the Bahá’í their attaining equal status Writings: “… men and women with men are very important are equal in the sight of God for the future well-being of our … there is no distinction to societies. be made between them. The Men and women only difference between them complement each other in now is due to lack of education their roles and functions. The and training. If women are happiness and stability of given equal opportunities of humanity cannot be assured education, distinction and unless both are perfected and estimate of inferiority will treated as equals. disappear”. The principle of the equality A basic teaching common to of men and women does not all religions is the requirement imply sameness or identity to treat others as we ourselves of function. “In some things would wish to be treated. women excel men, in others This is only possible through men are better than women, acceptance of the principle of while in very many things the the oneness of humanity (of difference in sex is of no effect every nation, race, religion or at all”. gender). In a family, for example, both Justice, peace and order in parents share in the overall an interdependent world can responsibility of educating their only be achieved if the principle children, but, the mother is of oneness of humanity guides given recognition of being their all interactions, including those first educator. between men and women. If Equality of the men and women are treated in the light women will bring about a of this ethical standard, we more balanced world, a world would definitely move beyond in which the more masculine many conventional beliefs that qualities of physical strength prevent women from having and courage will be balanced their rightful status in our by intuition, love and service; societies. 12 BUSINESS • SAKE www.bloemfonteincourant.co.za • [email protected] • 9 August 2018 Hobby turns into Dié agterstand sal jy nie kan uitwis

Wanneer markte onstuimig raak, en die FINANSIES booming business sentiment is negatief, sal ouer lede van EN aftreefondse gewoonlik meer konserwatiewe VERTROUE MOLEBOGENG MALEBO beleggingsopsies opsoek, om eerder hul kapitaal te beskerm na hul aftreedag toe. [email protected] Dit is dan ook die advies wat ouer lede aan jonger lede gee om te doen. HORACE TERRY What started as a hobby, became a Dit gebeur dan dat die jonger lede vergeet booming business for a young Bloemfontein om weer hul beleggingskeuse aan te woman. When it comes to producing pas na iets meer riskant, en sodoende Warren Buffet gelees het, onthou iets van special, unique African jewellery and goeie kapitaalgroei oor die langer termyn “koop laag en verkoop hoog”, en “oppas clothes, Motlalepule Makgosi Motlolometsi misloop. Wanneer markte onstuimig is, en vir die tropmentaliteit” besluit dat sy die is quite a force to be reckoned with. sentiment negatief is, sal dit wys wees om teenoorgestelde gaan doen as wat oom Her business started booming after a beleggingsadvies in te win. Faan aanbeveel, en sy skuif haar kapitaal woman approached her to ask about the Kom ons kyk na ‘n praktiese voorbeeld. na die aftreefonds se mees aggressiewe jewellery pieces she was wearing during an Ons het drie lede van ‘n aftreefonds wat ewe beleggingsopsie. In daardie stadium het event. The woman then invited her to her oud is. Kom ons noem hulle Dirk, Johan en Dirk, Johan en Santie, elkeen R3 miljoen in workplace to showcase some of her pieces Santie. Al drie van hulle is nog 30 jaar weg hulle aftreefonds gehad. So vlieg tyd verby, and she was referred to a number of other van aftrede. Dan is daar oom Faan. Oom en in 2018 besoek ‘n finansiële beplanner people. More doors started opening for Faan is drie jaar weg van aftrede, en hou sy die maatskappy en kyk na die stand van die Motlolometsi in the form of invites to local aftreefonds se waarde elke dag noukeurig drie se aftreefondse. and international exhibitions. dop. Dirk is steeds op die beskermingsopsie A more recent highlight of hers was being Dan kom die globale finansiële krisis in wat oom Faan 10 jaar terug aanbeveel selected as one of a handful of South Motlalepule Makgosi Motlolometsi, owner 2008, en markte val vinnig en ver. Oom het, sy gemiddelde groei oor die laaste 10 Africans to represent the country at the of Makgosi Creations. PHOTO: PIERCE VAN Faan tree vinnig op, en skuif al sy kapitaal jaar was 6% per jaar gewees. So is Johan Torino Fashion Week in Italy at the end of HEERDEN in die aftreefonds na die beskermingsopsie, steeds op die matige opsie, wat hy ook nie last month. “The experience was amazing. wat hoofsaaklik uit vasterente-instrumente 10 jaar terug wou verander het nie, en sy I‘ve done international exhibitions, but I’ve parents had to intervene and advised her to bestaan. Dieselfde dag tydens die teebreek gemiddelde groei was 8% per jaar gewees. never done a fashion show. The way people focus on her education, which she did until vertel oom Faan vir Dirk, Johan en Santie Santie, wat die teenoorgestelde gedoen responded to my work was amazing. They she matriculated. wat hy gedoen het, en hy raai die drie aan het as wat oom Faan aanbeveel het, loved my products.” She said that the She believes that beadwork is her calling. om dieselfde te doen. Al drie is tans op die het gemiddeld 10% per jaar gedoen. experience was a learning curve for her and “The beadwork path chose me, I didn’t matige beleggingsopsie van die aftreefonds, Die 2% wat die onderskeie portefeuljes she is looking forward to be going again chose it,” she said. hul bydraes is dieselfde, en hulle opbrengste meer gegroei het is nie veel nie, maar die next year. Motlolometsi is also a selfless woman lyk dus ook eenders. randwaardes lyk soos volg: Dirk se R3 Motlolometsi’s love for beadwork can be when it comes to taking care of others. Dirk skrik so groot, hy volg onmiddellik miljoen het gegroei na R5,4 miljoen, Johan traced back to 1998 while she was in high This can be seen through her passion oom Faan se raad, en skuif na sy se R3 miljoen het gegroei na R6,5 miljoen, school. This is when she started what would for empowering other women and the aftreefonds se beskermingsopsie. Johan en Santie se R3 miljoen het gegroei na R7,8 be later known as Makgosi Creations. Her youth. She is also the founder of Phelang kan nie veel omgee nie. Hy voel hy is nog miljoen (meer as R2,4 miljoen meer as die talent and passion for beadwork prompted Disability Home, an organisation that ver weg van aftrede af, en is nie lus vir al van Dirk). her to create pieces for herself which other provides care for children with cerebral die administrasie om nou beleggingsopsies Oom Faan se advies het dalk vir homself people took notice of. The demand for her palsy during the day. She often does te verander nie, en doen niks aan die gewerk, maar dit het Dirk duur te staan work grew to the point where it started awareness campaigns for her organisation saak nie. Santie wat onlangs ‘n boek oor gekom. getting in the way of her schoolwork. Her to garner support.

=PLYQV\]YV\^LLZ Augustus gaan alles oor die viering van fantastiese vroue: dié wat gekom en gegaan het, en dié wat elke dag onvermoeid werk om aan gesinne, besighede, gemeenskappe en ons land vorm te gee – vroue soos jy.

Sanlam gee erkenning aan en eer jou en die rol wat jy – dikwels ongesiens – vervul. Ons gee erkenning aan jou toewyding, en daarom het ons ’n reeks ﬁnansiële oplossings wat in jou individuele en unieke ﬁnansiële behoeftes sal voorsien.

Ongeag jou lewensfase, kontak my gerus vir professionele ﬁnansiële advies.

Dirk Taljaard FSA ™ Senior Finansiële Beplanner 087 940 7726 083 310 2166 [email protected]

Sanlam is ‘n Gelisensieerde Verskaer van Finansiële Dienste. 9 August 2018 • [email protected] • www.bloemfonteincourant.co.za • MOTORS 13

Your weekly motoring guide 9 AUGUST 2018 Bloemfontein Edition Flagship Toyota C-HR and updated Aygo launched

SEAN NURSE

OYOTA has had a relatively busy 2018 kW/185 Nm 1.2-litre turbo petrol motor with the unveiling of various updates whispers away, and despite my deep-seated Tand even entirely new model ranges dislike for CVT gearboxes, if driven with locally. restraint, the box, which is the only ‘box The Japanese brand has continued its option on the C-HR Luxury spec, is actually model assault with the introduction of a new quite pleasant. top-spec C-HR along with the updated Aygo. The latest range-topper is certainly not I had a chance to drive the newcomers in cheap, coming in a R422 100, some R45 Johannesburg recently. 100 more than the Plus auto, but Toyota C-HR now well specified being Toyota, I’m sure this model is the result I remember driving the C-HR in 2017 and, of customer feedback, meaning that there to be honest, I didn’t exactly think that the will be a demand for this particular variant. car was lacking specification; it pretty much Updated Aygo had all of the basics covered. But for those Toyota’s cute city car, the Aygo, has looking for a C-HR with all of the modern received a raft of updates and a few creature comforts, Toyota has now released additions to its standard specification. The the Luxury specification. biggest change is certainly the increased The new features include the addition of emphasis placed on the x-motif on the satellite navigation and a reverse camera to front-end, which now sports refreshed the colour touchscreen infotainment system, headlights with LED daytime running lights, textured (heated) leather seats, leather trim a redesigned front bumper and a black lower on the dashboard, LED headlights, keyless apron which allows the Aygo to now resemble entry with push stop/start, additional curtain its larger siblings. and driver’s knee airbags, electric folding The interior is very much the same as the down on the outgoing Aygo. The little engine, Both the Aygo and C-HR range comes with mirrors, Park Distance Control and Intelligent outgoing model, but Toyota has added Hill in combination with the five-speed manual a three-year/100 000 km warranty while the Parking Assist. Assist Control, colour-coded bumpers and gearbox, is good for a 0-100 km/h time of 13.8 C-HR benefits from a six-year/90 000 km There’s also a bi-tone paint finish which Vehicle Stability Control too all models. While seconds and a claimed fuel consumption of service plan and the Aygo’s service plan is an is either a black roof and choice of six body on the topic of models, there are four within 4.3-litres/100 km. optional extra. colours, or a white roof with a black body, the range; the simply unbadged base mode, I would be lying if I told you that it was Pricing while the tail lamps now feature a smoked the X-Play Black (red body, black roof) and possible to feel the minor tweaks made to the Aygo - R166 800 finish. If anything, the opportunity to drive the X-Play Silver (black body, silver roof) and motor, but if anything, the drive allowed me to Aygo X-Play Black - R169 100 C-HR again was refreshing. It is a seriously the top-spec X-Cite which features a folding reacquaint myself with what is essentially a Aygo X-Play Silver - R169 100 good product which not only looks completely canvas roof.Out on the road, I had a chance very good budget car that’s firmly targeted at a Aygo X-Cite - R193 100 outlandish from such a conservative brand, to cruise around the streets of Johannesburg younger audience. This is evident in the funky C-HR but also feels completely different from other in the little Aygo, which is has had its tiny styling, youthful interior and emphasis on in-car C-HR 1.2T - R336 000 Toyota models sold locally. 1.0-litre three-cylinder naturally aspirated connectivity with your smartphone thanks to the C-HR 1.2T Plus - R365 500 It’s the refinement and general fit and motor retuned to produce 53 kW/93 Nm, colour touchscreen infotainment system. C-HR 1.2T Plus CVT - R377 000 finish which impresses the most. The 85 two kilowatts more but two newton metres Service plan and warranty C-HR 1.2T Luxury CVT - R422 100

New, grown-up Honda Brio bows in Indonesia REVIEWED by the Small RS Concept indeed the RS, while the side profile is is sold separately as the Amaze without the at the Indonesia International Motor characterised by a sweeping shoulder line Brio suffix. PShow back in April, Honda has extending upwards underneath the rear Specification still unknown, while up used the 2018 edition of the Gaikindo window, and a rear-end bearing not only front, motivation will come from a 1.2-litre Indonesia International Auto Show (GIIAS) similarities to the Jazz, but also the Civic four-cylinder petrol engine that develops 66 in the capital Jakarta to unveil the second hatch from three generations ago. kW/110 Nm. In Indonesia, the mill is mated generation Brio. As well as being noticeably bigger than as standard to a five-speed manual gearbox Incorporating a number of similarities the model it replaces, with an overall length with a CVT being optional. with the concept, whose exterior additions of 3 815 mm (+ 175 mm) and wheelbase of No pricing as yet been revealed or indeed will be kept as an appearance package over 2 405 (+ 60 mm), although height remains a local launch date, but expect availability to the standard model known in Indonesia as at 1 485 mm and width at 1 680 mm, the commence next year if given the all-clear by the Satya, the Brio sports a more rounded Brio also gains a full tailgate and a five-door Honda South Africa. front facia derived from the Mobilio and option for the first time, now that the sedan 14 CLASSIFIEDS www.bloemfonteincourant.co.za • [email protected] • 9 August 2018

Contact: Felecia 051-505-0926 CLASSIFIEDS 082-370-1270 [email protected]

interest in the matter to In die boedel wyle: 0000 0800 0900 the contact person given MARIA JACOMINA NEL ADDRESS: NOTICES VACANCIES LEGALS above before 02/09/2018. Boedelnommer: FW000234 5652/2018 Central Media Park DON’T DIY Meesterskantoor 0960 Bloemfontein 7 Christo 0073 Geboortedatum: Groenewald street PERSONAL 0820 0950 ESTATES 13 Januarie 1939 GENERAL ask them Identiteitsnommer: Wild Olive Estate, LEGAL NOTICES 390113 0005 081 Bloemfontein, OPREGTE Datum van Dood: 22 9301 BEESHONDJIES TEN Kennisgewing aan Junie 2018 KOOP INGEENT EN ELEGANT CLASSY EIA PROCESS krediteure en debiteure Laaste Adres: ONTWURM BLONDES & WHY in bestorwe boedels Huis Vergesig, SKAKEL 0794933800 Matheystraat, Zastron FW000239 BRUNETTES NEEDED Notice is given of an To place your service advert, Krediteure en debiteure in bostaande boedel word DEADLINES: application to the Free call: 051 505 0926 In die boedel wyle: 0100 Busy Gentleman`s Club State Dept. of Economic, or whatsapp 082 370 1270 JOHANNA ELIZABETH hiermee versoek om hulle in East Rand. Small Business DU PLESSIS vooderings in te lewer en Deadline for SERVICES High Earing Potential Development, Tourism and Boedelnommer: hulle skulde te betaal by Classiﬁed advert Transport & Environmental Affairs 3840/2018 ondergemelde adres binne bookings in: Accommodation. (DESTEA) in terms of the Meesterskantoor n typerk van dertig(30) dae 0154 gereken vanaf datum van Bloemfontein 2014 EIA Regulations as Bloemfontein publikasie hiervan. Courant Voice: GARDENING / amended in 2017 under Geboortedatum: the National Environmental 23 Augustus 1934 Mondays 16:00 Call or Whatsapp RUBBLE REMOVALS 082-550-1660 Management Act 107 of Identiteitsnommer: Bloemfontein FW000215 1998 for environmental 340823 0011 084 MEV M J MARAIS Courant: Tuesdays A PIENAAR VERVOER authorization for the Datum van Dood: 19 Meubelvervoer. POSBUS 448 16:00 construction of chicken Februarie 2018 Vullisverwydering. Billike ZASTRON, 9950 houses for the Laaste Adres: pryse. André 0855 TEL. 083 990 3750 concentration of eggs on Huis Vergesig, 083 305 6321. SALES / MARKETING EPOS:smithprok FW000127 the Farm Tochgeluk 37, Matheystraat, Zastron @telkomsa.net Brandfort, Free State. The Krediteure en debiteure in FW000227 listed activities applicable bostaande boedel word DISCLAIMER: 0163 to this project are Activity hiermee versoek om hulle vooderings in te lewer en PLUMBERS WE ARE LOOKING FOR 5, (GN R.327), for the hulle skulde te betaal by APPLICANTS FOR A development and related Final advert proofs will ondergemelde adres binne REGIONAL SALES operation of facilities or be sent to clients via HAVE A BLOCKED n typerk van dertig(30) dae MANAGER IN FREE infrastructure for the EMERGENCY e-mail.If no response DRAIN IN BFN? gereken vanaf datum van STATE AND NORTHERN concentration of more than has been received by CALL DRAINLEMA 5000 poultry per facility publikasie hiervan. Barris: 083 455 4955 NUMBERS: 12:00 on designated situated outside an urban Vincent: 084 800 0325 print product CAPE. area, excluding chicks www.Drainlema.co.za younger than 20 days; and Rusfontein Dam, Free deadline, it will be FW000129 Requirements State. The listed activities Must have Matric / Grade activity 27 (GN R.327), for MEV M J MARAIS processed as approved applicable to this project 12 Certificate Valid Drivers the clearance of an area of POSBUS 448 Police: and sent for print.The are activity 27 (GN R.327), 0181 License & Own Reliable 1 hectares or more, but ZASTRON, 9950 for the clearance of an client will then be Vehicle Minimum of 5 less than 20 hectares of TEL. 083 990 3750 10111 REPAIRS area of 1 hectares or liable for advertising years` sales experience indigenous vegetation. EPOS:smithprok more, but less than 20 costs as per norm. Meet and exceed monthly @telkomsa.net hectares of indigenous FW000228 Please check that all sales targets Sales and Ambulance: vegetation and activity 40 marketing experience of The applicant is Barry details in your advert (GN R.327), The 10177 various products and Bekker. Contact are correct. expansion and related Kennisgewing aan services to FMCG Trade Consultant: Eko Also note that operation of facilities for krediteure en debiteure (Wholesale). Responsible Environmental, Suite Mahareng holds the concentration of in bestorwe boedels for focussing on the 227, Private Bag X01, Firebrigade: copyright to all poultry, excluding chicks Wholesale and Bottom Brandhof, Bloemfontein, younger than 20 days, material, which End Retail Sector in the 9324 or contact Richard 051 406 6666 where the capacity of the cannot be reproduced Trade. Williamson at: (Tel) 051 facility will be increased by in any way outside Salary Negotiable 444 4700, (Fax) more than 5000 poultry per Central Media Group. 0866976132 or email: [email protected]. In facility situated outside an Electricity: Applicant must reside in order to ensure that you EIA PROCESS urban area. the Bloemfontein area. are identified as an 051 409 2345 Please send your CV to: interested and/or Notice is given of an The applicant is Pieter INDEX: info@effective affected party, please application to the Free Du Plessis. Contact sales.co.za submit your name, State Dept. of Economic, Consultant: Eko contact information and Small Business Environmental, Suite interest in the matter to Development, Tourism and 227, Private Bag X01, Water: Notices 010 Please take note: if you the contact person given Environmental Affairs Brandhof, Bloemfontein, 051 405 8191 Services 0100 have not been contacted above before 02/09/2018. (DESTEA) in terms of the 9324 or contact Richard Personal Services 0200 within 14 days, please FW000235 2014 EIA Regulations as Williamson at: (Tel) 051 consider your amended in 2017 under 444 4700, (Fax) For sale 0300 application Property to let 0400 the National Environmental 0866976132 or email: unsuccessful. Please [email protected]. In Property for sale 0500 Management Act 107 of visit our website 1998 for environmental order to ensure that you Child line: Business Finance 0600 Deadline for www.effectivesales.co.za authorization for the are identified as an 0800 055 555 Motoring 0700 for more information. classiﬁed booking construction of chicken interested and/or Vacancies 0800 NB:Applicant to houses for the affected party, please Legal Notices 0900 complete the application advert Tuesday 16:00 concentration of poultry on submit your name, on our website FW000237 the Farm Fransina 2060, contact information and

Notices | For Sale Legal notices Property | Herbalists Services | Vacancies www.bloemfonteincourant.co.za • [email protected] • 9 August 2018 SPORT 15 USA international wants to learn at the Cheetahs MORGAN PIEK the Cheetahs, however, Free State rugby is in his [email protected] blood. His dad, Pieter, and grandfather, Gerard, both represented the Free State in provincial rugby. The number-nine jersey at the Toyota Cheetahs will be De Haas has applied for United Kingdom (UK) visas one of the most hotly contested this season with no less along with numerous of his teammates, however, it is than six scrum-halves in the current squad of players. more than likely that he will be a little more involved The biggest name in the position is that of the with the Currie Cup rather than the Guinness Pro14 for Springbok, Rudy Paige, while the two most established now. players in the Cheetahs set up are Shaun Venter and De Haas told Bloemfontein Courant that learning from Tian Meyer. the more senior statesmen such as Paige, Venter and The former junior Springbok, Zee Mkhabela, has also Meyer, will be the first objective during his tenure at the been at the franchise for numerous years, however, he Cheetahs. is most inexperienced of the established players in the “Talking about the abundance of nines, yes sir, there setup. are a lot of scrum-halves, but for me the biggest thing In comes the latest Junior Springbok from the is to be around those guys like Rudy Paige, Tian Meyer Free State, Rewan Kruger, as well as USA Eagles and Shaun Venter. international, Ruben de Haas. “As a young player learning from those guys every day, The seasoned campaigner, Shaun Venter, is one of the front-runners to wear De Haas was born in South Africa, however, raised taking their tips and just being around them in a high the number nine jersey in the Guinness Pro14 squad. in Jessieville, Arkansas. In 2018 he represented the rugby environment. PHOTO: MORGAN PIEK Central University of Technology Ixias in the Varsity “This will be my goal for the next two years – to learn Cup. He then played a handful of games for the Toyota what I can every day from the senior guys in order for Free State XV in the SuperSport Rugby Challenge, me to be the best that I can be.” before being called up to the Eagles by the former The Toyota Free State Cheetahs will kick off their 2018 Springbok assistant and Sharks coach, Gary Gold, for season against the Blue Bulls in Bloemfontein on 17 his full international debut in June. August, while the Toyota Cheetahs are to get their At only 19 years old, De Haas is certainly one of Pro14 campaign underway against Munster in Ireland the youngest members who has been contracted at on 1 September.

The 19-year-old American international scrumhalf, Ruben de Haas, crashing over for a his try during the contact session against the Griffons. PHOTO: MORGAN PIEK

Rooi ligte flikker steeds

Goeiedag “Ons Springbok-breier, Rassie KOLSKOOT Erasmus, het sy 35 spelers vir die Kampioenskapsreeks teen die All Blacks, Wallabies en Poemas aangewys en daar kan min fout daarmee gevind word. Tog bly ek lugtig en wil ek nie opgewonde GEORG VAN ECK raak nie, want wanneer hy moet terugval op die 33-jarige Francois Louw van Bath in Engeland, moet ’n man bekommerd Vir die Crusaders was Richie Mo’unga raak?” begin Sporie Bezuidenhou ons uitstekend, terwyl Elton Jantjies vir die indaba op dramatiese wyse. Leeus wisselvallig en huiwerig was. “Dis nie Erasmus se enigste probleem Daarom is dit vir my ’n skok dat hy nog in nie. Onthou, Lood de Jager is nog beseer die Bok-groep is,” laat Oom Sjert ook van en Marvin Orie is nou nie juis vir my ’n hom hoor. slot van internasionale gehalte nie. Eben “Wag manne, kom ons los so bietjie Etzebeth is as slot weer terug in die die rugby. Ons Proteas het die derde groep, maar hy het maande laas rugby eendagwedstryd teen Sri Lanka in Kandy gespeel. Gelukkig kon daar teruggeval met 78 lopies gewen en daarmee die word op een van die oorsese spelers, eendagreeks 3-0 beklink. Veral Reeza Willie le Roux. As oorsese spelers soos Hendricks met sy debuut-honderdtal Louw, Le Roux en Faf de Klerk gekies saam met Hashim Amla, JP Duminy en word, waarom het Erasmus nie ook vir David Miller met die kolf het uitgeblink,” Frans Steyn en Bismarck du Plessis laat verander Stywelip Carrington die kom nie?” wil Bontie Bonthuys weet. onderwerp van bespreking. “Die Leeus se nederlaag van 18-37 teen “Moenie ons atlete vergeet nie. Hulle die Crusaders in die eindstryd van die het 30 medaljes, waarvan nege goud, Superrugby-reeks in Christchurch laat in Nigerië op die Afrika-kampioenskap die rooi ligte vir my op die vooraand van verower. Caster Semenya het met haar die Kampioenskap-toetsreeks flikker. twee goue medaljes in die 800 en 400 vir Dit wys net weer dat die topspan van vroue die toon aangegee,” laat Oom Sjert die Nieu-Seelanders tweekeer so sterk weer van hom hoor. as Suid-Afrika se beste span is. Die Dié nuus verander die gemoedstemming grootste verskil tussen die twee spanne en ons sluit vir ’n verandering rustig af. was vir my die spel van die losskakels. Groetnis. CLASSIFIEDS 7KURZLQJLWRXW" THURSDAY 9 AUGUST 2018 Komphela delighted with season’s start MORGAN PIEK The host came out all guns [email protected] blazing in the second stanza to try and finish off the visitors from The 2018/19 Premier Soccer the Eastern Cape. League season kicked off over In the 56th minute the striker, the weekend and if the first two Tshego Mabasa, was fouled in days of the season are anything the box and made no mistake to go by, it will be one thrilling in doubling the lead from the campaign. penalty spot. Bloemfontein Celtic will After the match, the be more than happy with coach, Steve Komphela, told their start to the season after Bloemfontein Courant that with securing a brilliant 2-0 win over Orlando Pirates and Kaizer Chippa United at the Dr Petrus Chiefs to be played in the Molemela Stadium on Sunday. Celtic overcame all the odds to secure the three points ‘It was which see them second in the standings, although it is still crucial that early days. Last week Celtic only had one we started training session after the players went on strike again, due to with a win unpaid wages. This promoted the South African Football Players’ Union to finally step in coming weeks, a win was vital. to try and defuse the situation. “It was crucial that we started There were even fears that the with a win. But again, something team would not pitch for their you don’t want to say, is that season opener, and polices’ riot when you play Chiefs, Pirates The new Bloemfontein signing, Tebogo unit was in attendance at the and Sundowns, logic dictates Potsane, was out to impress against slaughterhouse to deal with any that the expectations are that Chippa United, and that he did. The little trouble. they have to win. So it is good to winger threatened the Chippa defence The first half was somewhat of play them because they are not throughout the game and scored on debut for Celtic in the 41st minute. PHOTO: a dull affair with the two teams your direct competitors. MORGAN PIEK sizing up each other, but after “So when you play against numerous threatening runs them and get a good result, it into the danger zone, the new builds your character and helps competitors, teams of our calibre. Celtic will host Orlando Pirates in *At the time of print the Golden boy, Tebogo Potsane, broke your confidence. And if the When you play Chiefs, Pirates Bloemfontein on 19 August and Arrows versus Bloemfontein the deadlock in the 41st minute opposite happens, again you and Sundowns it’s easier. When are away to play Kaizer Chiefs on Celtic match had not been played howler. say it is okay, we have our own you get the results, it is tops.” 29 August. yet.

09 AUGUST 2018